How Does Devizes Confetti Battle Compare to the World’s Most Bizarre Festivals?

Perhaps the most interesting part of our chat with DOCA coordinator, Loz, and definitely, the most controversial was the carnival’s date change. Still social media comments groan that Confetti Battle was traditionally on a Wednesday. Yet, bringing it to a Saturday makes it feasible for higher attendance, particularly tourists and day trippers.

Loz expressed it could be as renowned as the Cooper’s Hill Cheese Roll, and intends to diversify and extend the concept to interest a wider audience. In Devizes we take it for granted people annually gather in the Market Place to fling confetti at each other, without contemplating how bizarre this notion is to outsiders. Bizarre attracts adventurous visitors, hunting for something different; they’d come, they’d spend money, but less likely on a Wednesday evening.

rainforeest.jpg

This morning I read a blog about The Rainforest World Music Festival, three days partying in the rainforest near Kuching, Sarawak in Malaysia. Okay, the English was poorly translated, but the photos wowed. Given I’ve jested the word “festival” these-days seems to be a new-fangled soundbite whereby anyone can pop up a gazebo, hire a man with a guitar, sell some tinnies and allow gatherers to piss on his rhododendrons, and dub it a festival, it got me thinking exactly what constitutes a festival, internationally, how bizarre do some get, and how does our Confetti Battle compare?

coopershill

Investigation exposed some pretty outlandish and curious events, and some complete bonkers. Many you’d need to pack a suitcase for a lengthy flight for, others it seems are not so far away. The Coopers Hill Cheese Roll in Gloucestershire cropped up more times than injuries undoubtedly caused there, but nowhere have I discovered mention of Pewsey’s locally eminent Wheelbeerow Race, or Devizes and the weird custom of lobbing confetti at each other. Think outside the box, or Brittox, it is a tad weird, guys; but both on weeknights.

moose

Do they compare in weirdness to a moose dropping festival? Talkeetna, Alaska, it’s not snow falling from the sky, but moose poo, painted white and dropped from a helicopter! Or the International Hair-Freezing Contest in Yukon, Canada, where, as the name hints, using only water and the frosty air, contestants freeze their Barnett Fair into the most peculiar and eccentric shapes?

hair
Go under, check my pubes

While some are just ascetically bizarre, like the Burning Man in the Black Rock Desert of Nevada, or Florida’s Underwater Music Festival, it’s the theme of many which alarms or amuses; Roswell obviously has a UFO Festival. Devon’s Blackawton International Festival of Worm Charming, is a thing. The World Bog-Snorkelling Championships in Llanwrtyd Wells and Ashbourne’s toedium smack down, the World Toe Wrestling Championships are too.

bog
I want to be just like him when I grow up

Wife Carrying Championship, anyone? The wedding vow of husbands metaphorically carrying spouses in times of sickness is taken a smidgen too literally in Sonkajärvi, Finland. Awards for the swiftest, toughest and amusingly costumed pairs are handed to contestants who carry their wives across a 254-metre obstacle course. But at the Festa del Cornuto, outside Rome, the Festival of the Horns, the men of cheating wives’ parade, crying and smashing possessions they gifted them to honour and console their woe.

wife
I’ll give you put the cat out!

Confetti Battle is a tad more family-orientated, like Krampusnacht in Germany, where every December an anti-Santa hands every naughty kid a lump of coal. Why not dress as devils and jump over our babies, because it has constituted a festival for over four-hundred-years in Castrillo de Murcia, Spain? If you think Don Quixote in a Lycra Satan suit leaping over your darling isn’t quite psychologically traumatic enough for them, how about Tokyo’s Naki Sumo, where oversized sumo-wrestlers square-up in a ring, each holding a baby, the contest being the first to make the other’s baby cry? Supposed to ward off evil spirits, so if your kid sees no fear in the wrester, the referee jumps in donning a scary mask to ensure a change of nappy is needed.

APphoto_APTOPIX Japan Crying Baby Contest
Think that’s scary? You should check my nappy, pal!

Some are pleasant, like the Cheung Chau Bun Festival in Hong Kong, where competitors’ climb sixty-foot towers of sweet buns which line the streets. Or the Floating Lantern Festival in Hawaii, and Beer Floating in Finland; steady, floating down a river in an improvised raft gulping Carlsberg. Others equal this pleasantness but add humorous elements, like the village of Brawby, where the Yorkshire Pudding Boat Race takes place over Bob’s Pond.

yorkshire-pudding-boat.jpg.638x0_q80_crop-smart
Who left that sausage in here?

Food leftover fights are commonplace, La Tomatina in Spain, The Battle of Oranges in Ivrea, Italy. I mean, sure, Rayne in Louisiana has a Frog Festival, and turkey testicle eating contests are widespread across the USA. Alongside the sinister Day of the Dead Festival, Mexico has Noche de Rábanos at Oaxaca, or “The Night of the Radishes.”

radish
We are the Radish Army, arm your salad!

Korea has the Boryeong Mud Festival, where if you thought Pilton can get pretty filthy on a rainy July, you should see these lot engaging in mud photography workshops or having mud massages. But mud is great for the skin, ambiguously, especially the Boryeong mud used in their cosmetics. Or the valued tradition of Hadaka Matsuri in Okayama, where 9,000 naked Japanese men wrestle for sticks thrown by a Shinto priest. If the winner puts the sticks into a wooden box with rice, he will be contented the whole year.

mud
Anyone got a chewing gum?

Equally as cringeworthy to me, but hey, you might fancy the Japanese Kanamara Matsuri, or festival of the penis. They have penis artworks (unsure if they’re pictures of dicks or drawn with one, like drawing using a fat, wax crayon in your left-hand,) penis-shaped sweeties and carved vegetables, decorations, and a phallic mikoshi parade. Yet again the logic centres around a shrine once popular for prostitutes to pray for protection from sexually transmitted diseases. But legend has it, a Vagina Dentata demon lurks inside vaginas to castrate young men on their wedding night. If told that, you’d be celebrating the prosperity of your manhood.

penis
I always dress like I’m Nigel Farage

Finland’s Air Guitar World Championships claims the ideology would end wars, stop climate change and eradicate all bad things. So, all of them have a history, or logic behind them, no matter how bizarre they may seem. Peru’s Cat Food Festival, for example, you may think this annual gathering in Cañete, where they munch on cats is to cull an overpopulated stray cat problem, but no, they breed the animals especially for human consumption at the gig. Apparently, cat meat has aphrodisiac properties and also prevents ailments in the bronchi; I’ll skip it and just try the veg, thanks all the same.

At least Thailand’s annual Monkey Buffet Festival isn’t as bad, despite the alarming name, it’s the monkeys who get a feast, not us nibbling on monkey meatloaf. They honour the descendants of a monkey warrior in Lopburi, and it’s a crowd-puller. Seems disease-spreading blood-sucking pests get honoured, The Great Texas Mosquito Festival brings three days of carnival to Clute; food, drink, games and rides, craft or cooking workshops.

monkey
Hey, where’s the KP Skips?

Confetti Battle roots to Carnival in 1913, where confetti and rose petals were thrown by the crowd at people in the procession. The tradition evolved into a fully-fledged battle around 1955, started by Jim Jennings, but the reason is unknown. Maybe we need to make one up; a nobleman’s wedding that went horribly wrong?

bull
I’m just nipping into Greggs

Even bulls rampaging around the streets, averagely injuring three hundred people and killing fifteen at the Fiesta San Fermin, doesn’t stop people gathering and making a festival out of. Why then, should changing our relatively harmless confetti battle from Wednesday to a Saturday bother you?! I’m not suggesting we have a penis fest, or eat cat, but what Devizes has is unique, and could be on this list!

Devizes Confetti Battle
Devizes Market Place – Saturday 31st August 2019
Entertainment starts from 7.30pm
Battle commences 8.00pm


© 2017-2019 Devizine (Darren Worrow)
Please seek permission from the Devizine site and any individual author, artist or photographer before using any content on this website. Unauthorised usage of any images or text is forbidden.


 

Adverts & Stuff Like That!

spidermilkman

wildingcellaeknatiurbanbargevinylrealmnewadvertadsilverfcfemale201965217389_1310844582401986_2449299795982942208_o

We see Same Days

Extensively featuring Devizine’s friend, Finely Trusler, half of Larkin and The Truzzy Boys, a new single from Same Days, a twenty-year-old London born Swindon performer is out for streaming today. Real name, David Whelpdale is cousins with Fin. He’s built an audience since a debut single in April, trying his hand at producing too. With Funked Up Dad, Martin, and Fin’s other cousin, Harvey, making up the other half of The Truzzy Boys, I had to ask Fin if he has any non-musical relations.

“Not many, mate!” was his answer, simple but to the point. Though this is something altogether different, as Same Days adopts that prevalent merger of singing with rap, popularised by the likes of R. Kelly. Yeah, alright, I’d need to speak to my daughter for more present comparisons! Still, old fart or not, I like it; “You See Me” offers a smooth and confident rap which oozes in and out of adroit boyband vocals. With natural ease this slick contemporary composition lustres authenticity with Fin’s acoustic component, harmoniously breathing air away from any unethical stereotype of rap fuddy-duddies may wrongfully spurt!

The accompanying video also assists with this acoustic measure, taking to the woods and other natural landscapes for locations rather than the banal urban scene. See for yourself, and all the best with it guys!


© 2017-2019 Devizine (Darren Worrow)
Please seek permission from the Devizine site and any individual author, artist or photographer before using any content on this website. Unauthorised usage of any images or text is forbidden.


 

Adverts & All That Malarkey!

spidermilkmanknatiwildingcellaefemale2019vinylrealmnewadvertad

Choo-Choo, Train to Skaville Supported Neville Staple at Parkfest!

Some years back I was told a ska band played the previous night in the village across the dual carriageway. Being an aficionado of the genre, I was disappointed to hear I’d missed it; good enough reason we now have Devizine so you need not be like me and can hear of events before they happen!

Informed the band was called Train to Skaville worsened matters; such a great name, taken from the 1967 single of Jamaica’s harmony group, The Ethiopians. The launchpad for a UK tour when it hit our charts, the song’s riff has been applied to many later songs, including Toots & The Maytal’s 54-46 and heralded the concept of the chugging train sound used in a plethora of later ska and reggae songs.

Despite ensuring I’d added all their local gigs to the event guide here since day dot, and befriended singer Jules Morton as part of the all-female fundraising supergroup, The Female of the Species, the must-see box on my perpetually cumulative to-do-list remained unticked, until last night. Unfortunate weather clouded sanguinity early on when I ventured over to Melksham for the opening of Party in the Park. An evening dubbed “Parkfest,” separated from the main event happening today, as what once may have been a welcoming gig, has spawned its own identity; the main event builds on universal pop appeal, Parkfest has a more matured feel.

IMG_2760

It was in chatting with Bruce Burry, event coordinator at the Assembly Rooms, which revealed this forthcoming grand line-up of ska. I was taken aback, Party in the Park is Bruce’s baby, and boy, does he take care of it. Impressive and vast is the setup at King George V park, professional is the stage, sound and effects. I’d heard of it before, but when Bruce uttered the name Neville Staple, my heart whacked into hyperdrive. Some months on, I was kindly invited backstage, as the support, none other than my burning-box-to-be-ticked band, Train to Skaville, prepared and tuned. Attempting optimism, my mutterings that once they took the stage the drizzle would cease met with sullenness, but guys, I was right, wasn’t I?! Call me Michael Fish.

 

Naturally, headline act, the original rude-boy, formerly of The Specials and who later formed Fun Boy Three with Terry Hall and Lynval Golding, Neville Staple excelled with sleekness and anticipated competence. His combo group, The Neville Staple band has become the stuff of legend amidst the ska scene since 2004. Again, akin to our review of Trevor Evan’s Bardbwire at Devizes Arts Festival last month, Neville’s outfit merges two-tone and punky reggae back into its precursor ska, for this explosive melting pot, prevalently fermented the anniversary of Two-Tone Records, the Coventry record label which spurred a scene and both aforementioned artists played a pivotal role in.

IMG_2767

However, this was not before Neville and friends ran through some Specials classics, and if classics are the given thing in this retrospective amalgamation, Train to Skaville knocked it out of King George Park, prior to this fabled performance. For the headline act was grand, this should be taken as red, and despite my pedestal I popped Train to Skaville onto, they surely flew above all expectations.

For blending 007 (Shanty Town) into The Tide is High, as a teaser, the burgeoning crowd began to yearn for their start time, as gratis was handed to DJ setup, Fun Boy Two, Train to Skaville stepped up to an audience clearly familiar with the panache of this local band.

Train to Skaville have been on the circuit for eight years, albeit it a number of roster variations through their time, partly the reason, Jules told me, for not putting down any original material. This if-it-ain’t-broke attitude fitting, for the majority of ska followers just want to hear the anthems. While this is done timelessly by many-a-cover-band, Train to Skaville sit atop this standard, their unique style, singer’s Tim Cross’s witty repartee and entire band’s expertise reeks of good-time ska and explodes with party atmosphere.

IMG_2756

For what seems to be a rare thing, a ska band from the Trowbridge/Melksham area, they set the bar high, and through Israelites, Too Much Pressure, and Rancid’s Timebomb to name but a few, they launched back on stage, slowing for reggae and rock steady classics, Hurt so Good and Is This Love, and detonating the finale by slipping back into ska with Prince Buster’s Madness, followed by Madness, Selector and Bad Manners hits and a sublime versions of Tears of a Clown.

Yet this train doesn’t seem to call at Devizes, and if word of the group of friends from Devizes I was delighted to meet there, Vince Bell, Tamsin Quin and significant other halves, isn’t enough to convince you I don’t know what is! The last train pulled out of our town in 1966 and I can’t wait for the Devizes Parkway project to become a reality, the angle of this piece is simply that someone needs to book this lively band in our town, we can’t let the Sham take all the spotlight! They’ve rammed pubs, gigged The Cheese & Grain, supported Neville a couple of times previous, and become hot favourites westward, we just need to stop them buffering at Seend!

 

As for Party in the Park, the main event kicks off this afternoon, a more pop-feel, they’ve some awesome local legends, including Indecision, Kirsty Clinch, Burbank, Forklift Truck, along with a fire-show, unicorns, fairground and food and drink stalls, topped off with a Take That Tribute. You can get a ticket on the gate, this an affordable event and the pride of the Sham.

IMG_2769


© 2017-2019 Devizine (Darren Worrow)
Please seek permission from the Devizine site and any individual author, artist or photographer before using any content on this website. Unauthorised usage of any images or text is forbidden.


 

Adverts & All That Malarkey!

spidermilkmanmelkpartysaddlebrattonartwildingcellaeknatinewadvertadcavifestvinylrealmurbanbarge65217389_1310844582401986_2449299795982942208_ofemale2019

Your Friendly Neighbourhood Milkman!

After the results of our dare, I’m going to do it, but not without your help raising some awareness of Carmela’s Stand up to Muscular Dystrophy…..


UPDATE!

Thank you for the kind donations, we’ve made £100 so far, but Spiderman isn’t coming out to play unless we can get some more!! Please donate to my dare, whatever you can will be a great help to Carmela and her family. A big thank you to The Gazette & Herald for covering the story, and Claire Perry MP who retweeted our campaign on her Twitter page.

I was delighted today, as for the first time I met Carmela and her mum, Lucy, when they came for a visit and, if a little hot and bothered, we posed for some photos! If anything though, it’s made it feel so much more real about doing this silly thing!

Img_2770cropcop3crop2

Donate Here!


Writing my rant column about Devizes on Index, some years ago now, would rattle some cages on Facebook. The satire soared over the heads of some conservative-minded individuals. One commented “don’t give up the day job.” I replied, “for the record, I love my day job,” and, weather permitting, I do.

When children say what they want to be when they’re grownup, they tend to suggest jobs they see around them, a teacher, a policeman, something like that. With a love of drinking milk, I wanted to be a milkman, among other things. I’d take the bottles out of my fridge and place them on the neighbour’s doorsteps. They’d knock our door, bottles in hand, saying, “I think he’s been at it again!”

milkfloat.jpg

Forward wind some decades, I figured of all the things, becoming a milkman was as unlikely as my idea to be an astronaut, being supermarkets had seen off the trade. When the job came up at Planks, I gave it a go, and after five years, never tire of it. There’s a tranquillity, a gratifying element to it beyond your average delivery driver. We are the fourth emergency service, supplying milk to those in far-flung villages who otherwise would have to travel some distance. This is warmly appreciated, particularly from the older generation, and with ecological awareness on plastic, the occupation is back in fashion.

Just so you know, Devizine is a hobby, you’ll be sadly mistaken if you think it prints money. Still, love doing this too. It became apparent when I made it a regular joke, readers thought it strange or didn’t believe I was really the milkman, so a month ago I posted video proof. Being I get quite a few strange looks, this day and age, trundling around in a milk float, it wouldn’t make the slightest difference if I did it dressed in my Spiderman onesie; would it? I asked you all if you’d dare me to do my milk round in my Spiderman onesie!

With great milk deliveries must also come great responsibilities, never ran over a hedgehog yet; they’re too fast for me! The poll exposed a slim majority (98%!) dared me to do it. So, I half-heartedly accept the challenge, but ask you to put your money where your mouth is; think we can raise some funds for Carmela, a five-year-old girl from Lavington with a very rare form of muscular dystrophy called LMNA Congenital Muscular Dystrophy? Then, I promise, to dooooo ittttt.

LMNA-CMD is a progressive muscle wasting disease that weakens the skeletal muscles, to the point where Carmela relies on a powerchair fulltime and needs someone to do everything for her. The heart and lungs are affected too. LMNA-CMD is incredibly rare with around only 50 known cases in the UK. Many years ago, affected children would typically die before the age of ten from respiratory and heart complications, but modern intervention has seen an increase in life expectancy. Carmela now has a 60-70% chance of living to sixteen. If lucky, she could make it to her twenties.

carmela1

All parents live to wonder, myself included, to their children’s future and inspire and encourage their success, as I watch my daughter run rings around me, football glued to her feet, I cannot imagine what life must be like for Carmela and her family at times. Though Carmela rarely doesn’t wear a smile. I’m no superhero by wearing a Spiderman onesie, more of a loon, but Carmela is.

Mind you, I received word she prefers Wonder Woman, but to see me in blue starry hot-pants is a step too far!

carmela3

There is no cure or treatment to slow down the disease but to help with the discomfort, pain and stiffness that comes with a progressive muscle wasting disease, Carmela requires daily mobility and stretching exercises, massages, hydrotherapy, swimming, and cycling using an adapted trike for low tone children. As her disease weakens her, adaptations in the garden and specialist equipment will change, costing in the thousands. For more information on Carmela’s story, see here: http://www.carmelasstanduptomusculardystrophy.co.uk/

My spider-senses are tingling, telling me I’ve got to do this, on Friday 9th August, weather permitting. I will take some photos and make a video diary of my morning, travelling through: Potterne, Worton, Great Cheverall, The Lavingtons, Easterton, Urchfont, Chirton, Patney, Beechingstoke, Woodborough, Marden and back into Devizes, before returning to Plank’s Dairy in Poulshot. I’ll also try a live stream to our Facebook page for the last part of the journey, and Carmela may join me at some point too! If this isn’t enough proof for you, I plan to stop outside the Bear Hotel in Devizes, Friday mid-morning where you can meet and laugh, I mean cheer me on!

carmela2

If there is to be a gathering, and any of my musical friends are free, I’d welcome you entertaining the any gathering few with an acoustic song or two, please let me know guys!

On the day, you should be able to track my progress on the Devizine Facebook page, and I’ll announce an ETA back into town; do, if you can support me, there will also be a bucket for donations, or you can use this donation page here. Please, I know times are tough, but one thousand four hundred bods like the Facebook page, near 40,000 of you read the website annually, if everyone just gave a pound coin, it’d make a massive difference to Carmela’s life. She’s such a happy-go-lucky five-year-old, despite this condition, and refuses to let it prevent her from smiling.

Here’s the link, let’s get this to as much as we can, help me by sharing and caring! If Steve Ditko could see me now… probably cry with laughter!

spidermilkmanphoto
Click to Donate!

Adverts & Stuff Like That!

62421161_2547566181944188_7910508312376901632_ocavdischauntedpostnewadvertadknatimelkpartywildingcellaevinylrealmsilverfc65217389_1310844582401986_2449299795982942208_ofemale2019

 

REVIEW –Vince Bell – 7th July 2019 @ The White Bear, Devizes

VB @ the WB!

Andy Fawthrop

 

OK so it’s the day after the (wonderful!) Devizes Beer Festival and you’ve worked your way through the hangover. You’re starting to feel normal again, but the sun is still shining, the world is still a beautiful place, and you really don’t want to start thinking about Monday just yet. What you gonna do?

Well, here’s a possible solution – head on down to the White Bear. Let me explain.

The White Bear (one of the oldest pubs in Devizes, blue plaque on the wall, blah, blah, blah) is rather on the up over the past few months. New landlords Marc & Georgie have been transforming the place since they moved in. Not only do they have an agreement with Wadworth that the pub can also supply a limited range of non-Wadworth beers on their pumps, and not only has chef Marc shaken up the menu with some glorious and interesting new food choices, and not only do they have some wonderful B&B accommodation, but now they are experimenting with providing a new laid-back music venue.

vincebear1

The plan is to feature a different artist every Sunday in the 5pm to 7pm slot, in a small, intimate venue with good food and beer, and to create a pleasant and laid-back vibe, perfect for winding down the week-end.

First up this Sunday was local musical hero Vince Bell. But before he took to the mic we had a great support slot from Fraser Tilley, who turned in an enthusiastic and lively set featuring both original and covers material (Marvin Gaye, Stevie Wonder, T. Rex and others). He in turn was supported by drummer Tim Watts, laying down some very gentle percussion accompaniment (having played with It’s Complicated at the previous day’s Devizes Beer Festival). The two of them provided exactly what was needed – an uncomplicated (geddit?) drift of songs that had the audience listening and applauding.

After a short break, Tim stuck around to accompany main man Vince. Last time I saw Vince was a few weeks back at Long Street Blues Club, playing support act to Skinny Molly in front of a very large and noisy audience. On Sunday the audience was much smaller, much more intimate, but equally enthusiastic. Vince seemed relaxed and quickly established an easy rapport with the assembled crew, which (obviously) included many local friends. His choice of material was good, mixing his own self-penned numbers, with a few covers including those from a certain Mr Bowie, the Killers, David Gray etc. For an encore he asked the audience which they’d prefer – one his songs? Or a cover? The audience wanted both, and that’s what Vince obligingly delivered.

vincebear2

So, for the launch of yet another musical venue in The Vize, was it a success? An unequivocal thumbs-up from here – good venue, good beer, good food, nice cool atmosphere and, of course, some great music.

Future gigs are to be announced, but next Sunday (14th July) is already lined up with Bristol-based singer/ songwriter Andy Juan.


© 2017-2019 Devizine (Andy Fawthrop)
Please seek permission from the Devizine site and any individual author, artist or photographer before using any content on this website. Unauthorised usage of any images or text is forbidden.


 

Adverts @ All That!

newadvertad62421161_2547566181944188_7910508312376901632_ocavdischauntedpostmelkpartywildingcellaefemale2019vinylrealm65217389_1310844582401986_2449299795982942208_o

Devizes First Scooter Rally; A Historic Weekend

Chatting to Gouldy of the Daybreakers, due to play Minety Festival the following day, we mutually complimented the setup at The Devizes Scooter Rally. Pleased for his input, as there was always a risk, being this is my first scooter rally, that any review would be comparable to a festival. Prior to the event, I admit I was mindful to this, telling myself not to hype it, as it’s a scooter rally, not a festival. Yet Gouldy described the archetypical rally as lesser in design and setup than your average festival. Given this notion I encouraged The Scooter Club to embrace wider appeal; they were in agreeance, it wowed and will undoubtedly go down in Rowde’s history.

This paid off, for two years in the planning, and some bumps between us along the way, the Devizes Scooter Rally was uniquely designed and executed with individualism and panache, binding a positive festival vibe with the style of a scooter rally, surely producing an event to shame other similarly labelled events; and all for the first time too.

scooter2

Booking The Tribe, Swindon’s hip hop-reggae whizzers, popular on said festival scene, was attributed to this notion; partly my suggestion, but to open wasn’t. Perhaps this wildcard could’ve fitted later, yet, their wider appeal indeed took the younger’s interest, even if not digested by traditional scooterists. They played an arresting and dynamic set as always, rapper AJ Mayhew joining the slight crowd for a dance momentously inspiring for the younger.

More so, it was the plentiful choice of food stalls, bars and side attractions which blessed this event with that genuine festival feel, as opposed to the average rally’s hashed barbeque, hosted by the least drunken skinhead, and the bar being the pub across the road! All slight, but there were fair stalls, rides and a bouncy castle to keep young ones amused. Food stalls of pizza, noodles, burgers, hog roast varied catering, retro clothes stalls and the Vespa Owners Club had travelled afar to join many local ventures such as Vinyl Realm holding their first stand.

Aside the brilliant homemade bar, with pumps and Pimms, which was reasonably priced even for a pub, let alone event, choices were also available, from separate coffee or Prosecco bars, and the strikingly Caribbean yet local rum distributor Muck & Dunder’s mobile bar, which I could make my second home!

20190706_172017

So fruitfully the Scooter Rally developed, combining the favourable elements of festivals and scooter rallies equally to create what they wished, done their own, localised way. Villagers and Devizes residents mingled with widespread scooter aficionados in a joyful ambience. Meeting enthusiasts who’d journeyed from the North, or Exeter, was amalgamated with strictly Rowde branded humour, such as parish councillor, dubbed “Rowde Mayor,” John Dalley, who had his head shaved by Tracie Lawson of Devizes Beauty Boutique for children’s cancer charity CLIC Sargent.

20190706_212249 - Copy

Late Friday evening, drinks may’ve flowed, but chatting to DSC Colonel, Adam Ford, there was little doubt, though the monumental organisation thrusted into an event of this calibre, that he’d do it all again, next year. For when it came together, a fabulous time was had by all and full marks must be awarded to all members of the club.

To nit-pick there will be lessons learned, the PA needed a little hoof, least villagers only went to their Facebook group to inquire where the wonderful music was ascending from, rather than complain. This came to a head at the concluding act, Bad Manners tribute, The Special Brew, who worked professionally through technical faults to bring a madcap finale we’ll be talking about for years to come. Lighting and washing facilities for those camping, may also have been on the hitlist, though elements ramp the ticket stub, and it was ever kept a reasonable price.

20190706_221145

Friday then, and local folklore heroes, The DayBreakers followed the Tribe, with their wonderful brand of folky-retro-pop. South-coast’s ska legends Orange Street headlined with a tight and proficient set of ska and two-tone classics, they simply astounded, leaving us with little doubt the weekend was a winner.

Trilbies must also be raised to the solo effort from renowned DJ Terry Hendrick in the marquee, who both filled in whenever necessary and bought each evening to a climax. Neither angered by my pestering, browsing his astounding collection of seven-inch rarities, he even allowed me a little taster on his wheels of steel!

20190706_160300-copy-2.jpg

Local retro covers band, Cover Up did a grand job opening Saturday’s live music, upon the return of the scooterists on a ride-out across Devizes and villages, parking by the stage for browsing devotees. For me, the highlight was always to be Swindon’s Erin Bardwell Collective, whose rock steady and boss reggae classics appropriately fit the sunny afternoon breeze. As well as Double Barrell, Let Your Yeah be Yeah, and Jackpot, there was a sublime cover of Horace Andy’s Skylarking, a blend of Harry J’s Liquidator with Staple Sister’s I’ll Take you There, and just one of their own songs, a new one called Just Loving You.

20190706_17261120190706_163620 - Copy

The Start bought the event to boiling point, Essex’s finest gave us a loud and proud varied performance, shelling us with iconic Two-Tone and sixties to eighties mod-rock anthems which defined the eras. The Start were confident and highly enjoyable, rousing the crowd for Special Brew. If it was an unfortunate technical fault, worry didn’t project dismay, they battled through and such was the unabridged event, it mattered not.

20190706_203305 - Copy

What a marvellous weekend, possibly the most bizarrely enlightening the village has ever seen, unless you different? Detroit USA, Kingston Jamaica, London, New York and Coventry; all established places on the soul & reggae map. Thanks to Devizes Scooter Club, we can now add Rowde to that map!

scooter3


© 2017-2019 Devizine (Darren Worrow)
Please seek permission from the Devizine site and any individual author, artist or photographer before using any content on this website. Unauthorised usage of any images or text is forbidden.


Adverts & All That!

female2019cavdisc62421161_2547566181944188_7910508312376901632_o65217389_1310844582401986_2449299795982942208_onewadvertadvinylrealmmelkpartycavifestskittles

Big Yellow Bus Project Comes to Swindon

In 2017 truck driver Gerry Watkins raised four grand to buy a double-decker bus which he converted it into a homeless shelter in Cirencester. The project was hailed a success and received media support, and live music fundraisers. With the Cirencester bus now fully refurbished with bed compartments containing timber-framed bunk beds, eating and kitchen areas with a wood-burner, Gerry vowed to bring the concept to other areas in the south west.

Today, he’s proud to bring the idea to Swindon, with a new bus in need of renovation. “I know Swindon needs more than just one bus, but this is a start,” he said.

bus2

Such an inspiring DIY story shows the individual can make a difference, yet Gerry is keen to add, “the whole project relies on the sheer kindness of the community and fundraising events to raise funds to purchase materials.” After a campaign to local businesses, Gerry wanted to purchase the bus for £2,900, and told BBC News, “it’s in pretty good condition for the money I paid for it.”

bus3

In March Charles Martell, the High Sheriff of Gloucestershire paid The Big Yellow Bus Project a visit along with a longstanding supporter, Lady Bathurst, to present a cheque for £500. But the funding needs to continue. A variety of events have been arranged in the past to do just that, from seaside coach trips to bingo and raffle nights, fund raisers have also included some great punk and ska nights in Cirencester and Stroud, with the backing of local bands such as The Strays, Shaggy Dog Raconteurs, Train to Skaville, Ska-Bucks, Sugar Motown and Plucking Different. Here’s hoping the support will be continued in this new project.

bus5

All the work carried out for the previous project was checked by the relevant authority and any homeless person using the bus must be signed up to a rehabilitation course. Gerry also hopes to set up training courses to help the homeless get back into work. We wish Gerry all the best with this outstanding contribution to a growing problem in the South West, please, if you can, show some support for this inspirational project, here.

bus4


© 2017-2019 Devizine (Darren Worrow)
Please seek permission from the Devizine site and any individual author, artist or photographer before using any content on this website. Unauthorised usage of any images or text is forbidden.


 

Adverts & That!

dnbskittles62421161_2547566181944188_7910508312376901632_omelkpartywildingcellaenewadvertadvinylrealmfemale201965217389_1310844582401986_2449299795982942208_o

Female of the Species, Back for 2019!

Even if they are deadlier than the male, Devzine still loves The Female of the Species. Separate they are dynamic performers, each assigned to the crème of local bands, but when they get together it’s like the Spice Girls were librarians. We’ve covered their Melksham Assembly Hall annual fundraising gigs in the past, now they look set to take 2019 too.

Recently announced date with the ladies then, 30th November and supported by some so far unannounced special guests, this show will be knockout, believe me, witnessed it last time. It’s becoming as traditional as Christmas, this annual jaunt for solo singer Charmaigne Andrews, Jules Morton of Train to Skaville, Nicky Davis of the Reason, Julia Greenland of Soulville Express and last but my no means least, the one and only Claire Perry of Big Mamma’s Banned.

female2019

They blend all their separate influences to create one super party as polished as Mrs Bucket’s (pronounced Bouquet) mantlepiece, and as about as much fun as an orgy in zero G, not nearly as fruity, but it does at times border. Devizine interviewed them all in one go, a occasion I’ve still not recovered fully from, and we celebrate this announcement with bell on.

So, bookmark the date, tenner tax, and all, I mean all, proceeds go to a chosen charity each year. This time it’s for Stepping Stones. Stepping Stones is an Opportunity Group for children with special needs. From Ages 0-5 with varying levels of need, Stepping Stones, based in Trowbridge, covers the West Wiltshire Area from Trowbridge, Melksham, Westbury, Warminster, Bradford on Avon and all the surrounding villages.

 

This non-profit organisation is only partly funded by Wiltshire County Council. Each year they have to raise £40,000 in order to continue to provide the service to the children. They pay for extra therapy sessions for the children and also fully fund both the Music therapy and Hydrotherapy sessions. There can be no better way to support this worthy charity then to party with the Female of the Species!


© 2017-2019 Devizine (Darren Worrow)
Please seek permission from the Devizine site and any individual author, artist or photographer before using any content on this website. Unauthorised usage of any images or text is forbidden.


 

Adverts & All That!

vinylrealm62421161_2547566181944188_7910508312376901632_ocavdiscsaddlemelkpartyhauntedpostnewadvertad65217389_1310844582401986_2449299795982942208_ocavifest

Daydreamers Run Away to a Fairy Tale Scene

The new single from Daydream Runaways is out on Thursday; I get a sneaky listen to it…..

Beginning of May and we had nothing but praise for debut single, Light the Spark, from indie-pop four-piece, Daydream Runaways. Since, they’ve enjoyed home gigs at Devizes’ Southgate, and Calne’s Talbot Inn, ventured further afield, supporting Aidan Simpson at Mr Wolf’s in Bristol and whipped up foodies on the main stage at Longleat Food & Drink Festival.

It’s little wonder why they’ve received glowing reviews on Broadtube Music Channel and OddNugget as well as right here, but just to confirm the dedication to their music is paying off, I’ve got the next single playing, due for release on Thursday (4th July.)

fairyta4

Continuing on the panache of uplifting indie with a danceable edge, the next single, Fairy-Tale Scene, delivers this with urgency and attitude, a romantic theme at its core. Universal lyrics evokes the lustful, living-for-the-moment ethos of an initial, chance meeting evident in modern relationships, rather than the heading’s reference to a fairy tale romance.

The opening riff reminds me the House Martins, an energetic Happy Hour track indeed, as it runs its two-minute-forty catchy melody pop-tastically, with slight eighties, pre-indie label overtones. Yet, I mean that in a good way, honest I do; it’s well-crafted, a smooth, beguiling number that I’d consider an improvement on Light the Spark.

I pictured the adolescent emotional closing of The Breakfast Club during my listen; Judd hands the earing to Molly and she slips it into her ear, as Simple Minds cry Don’t You Forget About Me. I don’t know about you, but my school detentions never ended anything nearly as quixotically starry-eyed!

fairy3

That was the beauty of those John Hughes teenage rom-coms, the endearing, fairy-tale conclusion, the sincerity of youthful relationships, of impending love against peer-pressure, but never without the evoking mood of a classic song, breathing gist and passion into the climax. Watch the final scene of The Breakfast Club, or Pretty in Pink with the sound muted, just not so tear-dropping without the song. That is the key to the theme of Daydream Runaways’ Fairy-Tale Scene, almost reflecting their namesake, and it drives it forward wonderfully.

If John Hughes had this single on his desk in 1984, he’d have been imprudent not to at least consider using it. Well done to Ben, Cameron, Nath and Bradley, they will be an unmissable hit at DOCA’s Street Festival, playing our brand-new Vinyl Realm stage, prior, catch them at the New Inn Melksham on the Friday 5th July for the launch party of the single, and later when they return to the Southgate on 30th August.

Pre-Save the single here: https://distrokid.com/hyperfollow/daydreamrunaways/fairytale-scene

fairyt1


Images by Anabella Kazubska

© 2017-2019 Devizine (Darren Worrow)
Please seek permission from the Devizine site and any individual author, artist or photographer before using any content on this website. Unauthorised usage of any images or text is forbidden.


Adverts & All That!

sharoncrabbeskittles62421161_2547566181944188_7910508312376901632_ovrstagecavdiscsaddlehauntedpostmelkpartyvinylrealm65217389_1310844582401986_2449299795982942208_o

REVIEW –Watermelon Slim – 28th June 2019 @ Long Street Blues Club, Devizes

A Fruitful Night

Andy Fawthrop

Final gig of the current season at Long Street Blues Club, and we went out with a bang with two great acts.

First up was local bluesman Andrew Bazeley. Having made this style of music his life-long hobby, I’d go so far as to say that what this guy doesn’t know about Delta Blues just ain’t worth knowing. He lives and breathes this stuff, and this is reflected in his playing – soulful, bluesy, stripped-back, atmospheric. His introductions and between-song patter are a delight for anyone who wants to know something about the songs they’re listening to – informative without being preachy. He told me before the gig that he was nervous, but it didn’t show one little bit. And afterwards said that it was probably the biggest audience he’d ever played to. No worries – the boy done good.

slim1

Then the main act. Two sets of howling, rasping blues from the trio fronted by Watermelon Slim. We started off, very unusually, with the main man introducing his band – before a note had even been played! But after that it was down to business. Slim himself alternated between playing his guitar lap-style on a table and his trusty harmonica, but always ably supported by solid drums and bass. The vocals were howling and husky-voiced, the playing effortless. The banter was self-mocking (“almost 50 years now”), drawling and laconic, betraying the man’s Deep South origins. Frequently Slim came off stage and into the front of the crowd to let his howling harmonica do the talking. And he talked a lot, and with laid-back humour. At times the performance felt a little hammy and hackneyed, pushing all the usual I’m-a-great-bluesman buttons but – hey – he IS a great bluesman, so who’s complaining? The audience certainly weren’t, lapping up both the chat and the music.

The start of the second set was my highlight – leaving his buddies backstage for a while, his opening number featured just acapella voice and that screaming harmonica – absolutely sublime.

slim2

It was a great finish to the current season, and I’m already looking forward to the next one. Ian Hopkins was very happy to discuss his forward booking plans and mentioned a few names, but I won’t steal his thunder until the new season is announced in full later in the year.

Great club, great venue, great artists and superb entertainment. A real advert for live music in our town.

 

Adverts & All That!

ScooterRallyposterNovskittleshauntedpost62421161_2547566181944188_7910508312376901632_omelkpartynewadvertad65217389_1310844582401986_2449299795982942208_ovinylrealm

 

Chatting Carnival with Loz

With a nail in the offside rear tyre, I’ve got a three-quarter of an hour window to nip to Mike Woods and stop for a drink at Times Square before the school run. Prioritise Worrow, prioritise; erm, just a cup of tea thanks, you get a little biscuit on the side anyway.

Loz Samuels beats me hands down when it comes to time management, it’s her second visit to coffee shop today, chatting and encouraging the progress of DOCA. Whenever I catch her, Loz laments how crazy it’s all been, yet I suspect she wouldn’t have it any other way. Appears to me she personifies the satisfaction of commitment so much it’s scary; procrastination not in her agenda, unlike me who lives by its golden rule.

loz.jpg

Skipping the announcement of Vinyl Realm’s second stage at the Street Festival, as despite being the reasoning for arranging the meeting, I measured both Pete and I too enthusiastic about the prospect to wait till now. Seems Loz wanted to concentrate on the subject of carnival and the nearby sub-events, opening with a partnership project with Amesbury Carnival. “We’ve created a six-feet high puppet of a mammoth,” she explained, confirming after some deliberation of the crane’s availably, it will stomp its way through our procession.

I note it’s the kind of thing you see at carnivals in South America or the Caribbean. “Yes,” she agrees, describing a second mahoosive moveable puppet of a Neolithic woman, “it’s quite colourful, because the theme is Through the Ages, so it works, it works well for them (the sponsors) because they wanted something to do with heritage.”

There was me thinking about an old British Pathe film showing a Devizes carnival of yore, but Loz explained the theme is more general, not as I thought, a historical look at Devizes Carnival. “No, just through the ages, you know, could be the future, could be aliens, but maybe someone will interpret it like that.”

So, carnival is on the 13th July this year, a change that’ll bring the walls down and make life no longer worth living, according to “traditionalists” on social media. In our last chat with Loz, we enlightened the reasoning for the change, aside the fatigue of DOCA’s volunteers with a full fortnight of events, the hesitancy of schools to contribute during summer holidays has opened up. Schools are able to work on their projects earlier in the year, and workshops have been running in seven participating schools, with others coming. The theme, Loz explains, is suitable for their curriculum too, be it Victorians, or pirates for example; one positive reason to change. Loz stressed how pleased she was with this change; carnival wouldn’t be carnival without the children.

Colour-Rush-Featured-image.jpg

We move onto the notion that the subevents, the Colour Rush and the strictly Devizes “thing,” The Confetti Battle can now be on a Saturday too, rather than weekdays as previous. “So hopefully,” she nods, “there will be masses there. We had four thousand there last year, and on a Wednesday night when you’ve got to get up next day, it’s quite late….”

“It’s going to be different every year, I mean,” she continued, “how many times are you going to go to Confetti Battle when it’s the same old thing?”

I agreed, despite my kids loving it when younger, they consider they’re getting too old to bother. “But they might do this year,” Loz interrupted ardently, “because there’s gonna be massive inflatable crazy things that’ll appear in the crowd!”

Loz’s hopes for additions to this year’s Confetti Battle are from Willy Wonka’s rulebook, golden tickets to win £50 in the bags of confetti, and more side attractions will add to its appeal. “The Confetti Battle could be nationally known,” she continued, comparing its potential to the Cooper’s Hill Cheese Roll, “but not on a Wednesday night. People aren’t going to be travelling from, say, London on a Wednesday night.”

bunting.jpg

Confident to grow this unique element of our carnival, Loz continued to express advantages of the battle commencing over the weekend, taking down the rigs in order for market the following morning will be a thing of the past, meaning a more elaborate setup. She had a meeting with the astatically pleasing festival, BoomTown, aiming to create a visually stunning spectacle with wider appeal.

If cynical of her ambitious outlook, Loz claimed, “the sky’s the limit, if we can raise money to put into it, then we can do it, we can do anything, so, it’s a start, I’m aware people are sceptical about changes but if we stay as we are, we’re not going to grow, we’ve no potential to make money, our arts funding will decrease.” Seems logical to me. We talked of possibilities, of Caribbean carnivals where the procession concludes into an arena for a concert afterwards. “I think it’s really exciting,” she stated, “doors are opening now.”

The crucial thing to note in this chat, is that this is only Loz’s third year at the helm, finding her feet has been uphill, with a system only documented only in her predecessor’s head. She now feels in a position to build on past experiences and deliver us the large-scale outdoor events we will be talking about through the forthcoming ages.

So, let’s get things straight right now, DOCA’s program of events is ever as lively, but with a few changes:


Saturday 6th July: Carnival Costume Making Workshop @ Wiltshire Museum:

Help prepare a large-scale costume to walk in this year’s parade. Families and children aged 8+ are invited to make some spectacular back pack style costumes. This will be a group making session working on revamping backpacks which will match with costumes made by our school groups, in either Medieval, Tudor, 18th Century, or Victorian style.

Artist and costume designer Abi Kennedy will guide you through making a colourful back pack, a fun and creative afternoon is promised. No experience is necessary.


Wednesday 10th July: Skittles Night @ The Wyvern Club

skittles


Saturday 13th July: Devizes Carnival Through the Ages.

Entrant registration from 4pm, Procession starts at 6:15pm.

62421161_2547566181944188_7910508312376901632_o


Sunday 18th August: Picnic in the Park @ Hillworth Park


Sunday 25th August: International Street Festival @ The Green


Monday 26th August: International Street Festival @ The Market Place

vrstage


Friday 30th August: Kennet & Avon Canal Trust’s Music by the Canal

6.30pm until 10pm @ Devizes Wharf.


Saturday 31st August: The Colour Rush

Starts at Green Lane Playing Fields and finishing in Market Place.


Saturday 31st August: Confetti Battle @ The Market Place

Confetti-Battle-featured-image


UduL by Los Galindos @ The Green
Los-Galindos-UduL-photo-by-Manel-Sala-Ulls-300x450.jpg

An award-winning Catalan circus company who inhabit a traditional Mongolian yurt which will be located on the Green for three days. Saturday 24th August: Doors 7pm Show 7.30pm, Sunday 25th August: Matinee Doors 1.45pm, show 2pm. Evening Doors 7pm Show 7.30pm, and Monday 26th of August: Doors 7pm Show 7.30pm. Minimum age recommended from 7 years. TICKETS: £5 Early bird price until 31st July, thereafter: £7 each, £5 for under 16’s.


Shop Window Competition

Shops around town have placed one item in their window, during Street Festival fortnight, that they don’t normally sell. Spot them all and be in with a chance of winning £25! Entry forms will be available online throughout the Street Festival Fortnight or from Devizes Books and the Town Hall. Completed forms can be left at the Town Hall.


logo230.png


Adverts & All That!

newadvertaddedicoatScooterRallyposterNovsharoncrabbehauntedpostmelkparty62421161_2547566181944188_7910508312376901632_o65217389_1310844582401986_2449299795982942208_o
vinylrealm

 

Devizes Nights: At the Southgate, Jon Amor, One and All

Images by Nick Padmore

In that year of the breakdancing fad waning my brother went off and bought Born in the USA, and we became Boss fans overnight. So, he nipped out and bought Nebraska too, and we were like, “oh…”

It took some time for my infantile mind, accustomed to pop, to appreciate acoustic, but as I listened to those dark portrayals, I saw the worth of the simplicity of just a person, a guitar and maybe a harmonica for good measure. I understood now, if a musician can strip back his music to the bear minimum and still captivate, they were among the most highly accomplished.

As Jon strummed the most popular song on his Colour in the Sky album, Red Telephone, singing “why don’t you call me on red telephone,” then adding “it’s 01380…” it produced a belly-laugh. I doubted it would elsewhere, being the audience recognised it as their own area code. I then considered if I need review this gig at all.

For Jon Amor is to Devizes as Springsteen is to New Jersey. He was among natives last night and with stripped back versions, some amusing covers and local banter, all knew what they’d come for. Do I really need to elucidate his excellence on a website with a commonly Devizes demographic?

jonsoothgate1

Do I need to outline how great the evening was and what great company we were in, being over the last year and half, the Southgate has become widely known as Devizes haven for live music and friendly, grassroots atmosphere? It’s rough and ready, it makes do with what it has, but the Southgate is, simply, the best pub in town for music, through dependability. You can scroll through Devizine to see what’s going on locally, don’t let me put you off that, but if you’re ever stuck for something to do, you need not, just head down there, because nearly every Friday and Sunday, and defo each Saturday you’ll find a cracking band or solo artist doing their thing without regulations, without pretence.

During the week it’s either quiz night or an acoustic jam Wednesday, we know what Deborah and Dave have blessed us with, need I really go on? It is Sunday, for crying out loud! I left only a two-word note on my phone for this review, “Word Up,” a reminder that Jon did a comical cover of. The rest of the time was spent catching up with friends amassed for Mr Amor, for free, as that is the ethos of the Southgate. So, do I really need to review this evening, when everyone who is anyone in Devizes attended, even both Devizine’s roving reporters? Maybe I could delegate the task to Andy?!

jonsouthgate2

Do I even need to whip out my little… (wait for it) … camera, when our own Nick Padmore is stood at the front with his sizable lens? Ack, I suspect you’re thinking now, lazy bugger; probably hungover. But truth be told, after walking uphill to town from my village for the past few weekends, I couldn’t face it this time, so I drove. Proof with the cracking combination of Jon Amor and the Southgate, with this blagger’s addition it was free, and so many gathered to chew the ears off, I needed not to intoxicate myself to have a blinding night. Shit, does this imply I’m mature? Bugger, I need to make up for lost time and have a Sunday afternoon drinkie. That’s me out of here, and no doubt unconscious on the sofa right after dinner!

Yet one thing you can be sure of, you need not feel sorrow if you missed it, The Southgate, check it out on our event guide, will continue to bring us many a grand and memorable night with Devizes written all over it, even if the enormity of Jon Amor is rare, you’ll never not be entertained by brilliantly sourced live music. Amen.


© 2017-2019 Devizine (Darren Worrow)
Please seek permission from the Devizine site and any individual author, artist or photographer before using any content on this website. Unauthorised usage of any images or text is forbidden.


 

Adverts & All That Malarkey!

vinylrealmdedicoatScooterRallyposterNovskittlesmelkpartyhauntedpost

cavifest

newadvertad.png

REVIEW –Skinny Molly – 21st June 2019 @ Long Street Blues Club, Devizes

Sweet Home Devizes

Andy Fawthrop

Just when you think the current season is over at Long Street Blues Club, Ian Hopkins sneakily adds a couple more gigs.

First up on tonight’s Friday gig, playing support, was local troubadour Vince Bell who delivered his usual thoughtful and well-polished set. Vince doesn’t always play the most cheerful or upbeat songs but, as he remarked later, he tends to go with the flow of whatever mood he’s in at the time. The audience didn’t give too much of a toss about that, judging by the well-deserved applause he received.

vincebelllsbc

Then Skinny Molly, a Tennessee-based four-piece, hit the stage to thunderous applause and got straight down to work. From the very first minute we were in rock territory, with heavy driving bass and drums, fronted by a pair of hot guitarists who meant business. This was loud-and-proud, take-no-prisoners rock and roll. And the guys looked the part too – plenty of black leather, hats, long hair, tattoos. Sounded like a rock band, looked like a rock band. All boxes ticked.

A couple of numbers in and the band hit Steve Earle’s Copperhead Road at full speed, an absolutely belting version of this great song, quickly followed by the band’s own If You Don’t Care, complete with squealing guitar solo. The crowd was getting warmed up now and we knew we were in for something special. The Devil In The Bottle served up all the standard licks, followed by a stunningly good version of Free’s Wishing Well.

Only after this did the band rein it in a bit to draw breath and to indulge in a little chat and audience participation. But then we got lots of good stuff about “the look” and how their wanderings around Devizes earlier in the day had gone down with some of the locals. Sainsbury and Poundland will never be the same again.

skinnymolly2

But then we were back to the music – including Sweet Home Alabama (what else from the children of Lynyrd Skynyrd??) which turned into a bonkers dance-floor-filler. Following rapturous applause we got a double-number encore, culminating in (what else?) Freebird, which morphed into a belting long jam of a number before everyone retired to a darkened room to have a quiet lie-down.

Great band, great gig.

Tickets still available for next Friday’s gig at Long Street Blues Club – Watermelon Slim, one of the blues greats.

 


© 2017-2019 Devizine (Darren Worrow/Andy Fawthrop)
Please seek permission from the Devizine site and any individual author, artist or photographer before using any content on this website. Unauthorised usage of any images or text is forbidden.


 

Adverts & All That!

jonsouthgatereggaemarldedicoatScooterRallyposterNovskittleshauntedpostmelkpartycavifestvinylrealm

Big, Music, Family, Fun @ Wiltshire Music Centre this Saturday

Kids banging their drum set upstairs, would-be guitar hero strumming in the lounge? Want to encourage them, don’t need the headache? I might have the answer to all your problems. This Saturday (22nd June) you need to get down to the Wiltshire Music Centre in Bradford on Avon, as it’s a Big Family Music Day over there, and for only £6, or £3 for under 18s and students.

What promises to be “a jam-packed day of fun for all the family,” The Music Centre invites you along to experience something new. There’s music and activities for all the family, including these varied workshops and things to do:


Discover / Learn / Perform with Wiltshire Young Musicians:

Come and learn a new instrument with our friends at Wiltshire Young Musicians! Discover brass, strings, wind or percussion before learning with outstanding teachers to prepare for a big performance in the Auditorium.


Bath Youth Folk Band:

Experience toe tapping reels and exciting jigs in this open rehearsal with Bath Youth Folk Band and get involved by singing, clapping or dancing!


Jazz Factory Workshop:

Learn how to swing and play the blues with Ross Hughes of Jazz Factory.


Drum West: African Percussion:

Tap away with Victoria and Chris from Drum West and discover the exciting music of West Africa.


Uke Lift: Ukulele Workshop:

Join Danielle from Uke Lift and pluck away in a large ukulele ensemble!


Free Stage: St Laurence School & Zone Club:

Sit back and enjoy performances from young musicians based across Wiltshire, including Wiltshire Young Musicians, St Laurence School and Zone Club.


WEYO Screening: West of England Youth Orchestra

Enjoy a recording of the West of England Youth Orchestra performing a recent new commission and find out more about the flagship orchestra.


Crafts & Activities:

Get creative making instruments for the Junk Band, get your face painted and enjoy fun outdoor activities in our family zone!


Food & Drink:

Bring a packed lunch or enjoy delicious pizza from Bianco Rosso Pizza or artisan coffee from The Coffee Girl.


Buy tickets here. For any other queries about the day, please contact Adam at adam.laughton@wiltshiremusic.org.uk

 

Adverts & That!

melkpartyreggaemarlvinylrealmcavifestjonsouthgatededicoathauntedpost

Diversity at MF Dance’s Showcase

Diversity will be joining MF Dance for hometown show in Swindon.

 
Red Sky Promotions are proud to announce that they will be bringing the awesome street dance troupe and Britain’s Got Talent winners Diversity to The Oasis, Swindon, on Sunday 1st December as the headline act at MF Dance’s hometown show.

MF Dance provide students with enhanced confidence, discipline, fitness and focus through the medium of Street Dance and for this special show case they will be delivering two shows as the main feature. These shows bring together performers of all ages from both Swindon and Oxford in a celebration of Street and Contemporary Dance.

redskyp.png

The event will be headlined by an exclusive, 30 minute set from Diversity. This world famous street dance outfit have completed eight sell-out UK tours so far in their career. Their latest tour, Ignite, saw them combine the world of street dance with the world of circus. The Swindon show comes hot on the heels of Born Ready – The 10 Year Anniversary Tour which marks a decade since the dance troupe won Britain’s Got Talent. Diversity continue to inspire the next generation of dancers and are about to launch their brand new online dance classes with 20DV.

Not only the best of local and regional contemporary dance but a special, one-off show from the hottest dance troupe in the country.
https://www.redskypromotions.co.uk/product/diversity-and-mf-dance-show/

 

Adverts & All That!

dedicoatjonsouthgateScooterRallyposterNovskittleshauntedpostlegallyblondeheadcavifestvinylrealm

 

Grupo Lokito Brings a Cuban-Congolese Fusion to Devizes Arts Festival

Images by Gail Foster

 

Can’t come out to play today, despite the finale of Devizes Arts Festival is all totally free. Three fringe events across town; The Hot Club (opps, nearly typed hot-tub then) at the Three Crowns at 1pm, Josephine Corcoran reading her poems and an open-mike session at the Vaults at 5pm and last, but not least, they’ve Circu5 closing the festival at the Cellar Bar, Bear Hotel at 8pm.

g6

For me, what’s been the best Devizes Arts Festival line-up ever, came to an explosive and marvellous conclusion last night when the Corn Exchange filled with the absolutely unique and gorgeous sound of Grupo Lokito. A packed Saturday night of the widest demographic you’d expect in Devizes, proves word is out; they’ve made a fool of anyone who attains this pompous, straitlaced pigeonhole they’ve so wrongly picked up. It has been a surfeit of talented and quality entertainment, amazingly diverse, and something our town should be very proud of.

g3

My thanks and praises go to all the organisers, who’ve worked their socks off but retained a smile and positive attitude throughout. So as the band members of Grupo Lokito mingled in the foyer, there was an atmosphere of delight for if this sundry group blend into a city’s world music setting, they were certainly a breath of fresh air in Devizes.

g5

The further away our ears travel from our perceived impressions of music, taken from what we’re exposed to at home, the harder it is, I think, to pinpoint and define the variety of styles. That’s what makes world music so fascinating. But, without recognisable covers or pastiches, and such a free-flowing sound, it does make a review somewhat tricky to write. Not helped by our brilliantly informative interview with Grupo’s keyboardist and manager Sara McGuiness, who outlined the nature of the band’s style.

g10

It intrigued me, Sara labelling the sound of the Buena Vista Social Club nostalgic and polarized, despite its positive effect in spreading Cuban music, to just how this night was going to go down. Indeed, Salsa dance classes had congregated, with their magnificently sassy style and gracefully romantic moves, yet I questioned if the music fitted. Salsa dancing tends to make use of traditional Rhumba, this was definably not. It was contemporary dance, do-what-ever-you-like dance, so while the salsa dancers didn’t look out of place, some arbitrarily bobbed along (myself included) and others tried to mimic the frontmen’s choregraphed hip movements, like guests on the Generation Game, none of it mattered. The concentration was on pure enjoyment of this glorious and peripheral style of music and it was thus.

g9

Evenly paced throughout, I observed this Cuban-Congolese fusion ecstatically. Noticing African sounds, like township jive in a particular tune, only for the next to be decidedly Cuban, and what followed them, a curiously exciting blend of the two to the point it neither mattered nor favoured one over the other; it’s just marvellous music without labels.

g4

I tingled when popping back to the foyer to ensure Devizes Market Place still existed and I wasn’t at Womad, informing photographer Gail it felt like I was on was holiday, a holiday I couldn’t actually afford!

g2

And that, in a nutshell, is the indication of a quality and exotic night. A big group hug for the Devizes Arts Festival, what a super conclusion…. Can we book Ziggy Marley next year, otherwise how are you going to top that?!

 

Adverts & All That!

vinylrealmdedicoathauntedpostlegallyblondeheadcavifestjonsouthgatequizconsskittles

Vinyl Realm Hosts New Stage at DOCA Street Festival

Yeah, it’s a toasty secret I’ve been busting to spill the beans on for eons; and we’re gathered here today to announce the line-up!

Sometime ago I suggested a local affair for DOCA’s amazing street festival on 26th August, just a small marquee-fashioned area, I imagined, set aside to highlight our local acoustic musicians. Like most of my ideas though, I throw away all practicalities and left it up to a fellow worker to causally whisper it’s a Monday and I’d be working in the morning!

Similarly, though, Pete of Vinyl Realm wanted to do something along these lines, and I’m delighted to announce he has taken the project under his wing and only gone done it, with bells on. The idea has expanded to a full-sized stage, with a great line-up that I’m here today to tell you about.

So, well done to Pete, Loz, et all, who’ve worked tirelessly to sort this out. Next week I’ll be chatting with Loz of DOCA about carnival and the street festival in general, but for now, all eyes on this, set to be the loudest alternative corner of the street festival, ever!

At this point, times of the bands performing are unconfirmed, as it needs to coincide with acts on the main stage. While DOCA’s booking of some fantastic international acts each year, it leaves us eager to know what they’ve in store for August; it’s secret left for you to buy a programme. But do save some room in your wandering for the Vinyl Realm Presents stage at the corner St Johns and Long Street, bang outside the shop.

daydream2

Ah, the new four-piece indie-rock band I’ve been harking on about recently, Daydream Runaways will be playing. Wiltshire-based Ben Heathcote on vocals, Cam Bianchi on Guitar, Nath Heathcote on Bass and drummer, Brad Kinsey. Citing influences from the likes of The Killers, The Strokes and Sam Fender, Airborne, they also praise Fleetwood Mac, The Stones and Talking Heads. We reviewed their excellent single Light the Spark a few months ago, and have high hopes for this youthful bunch.

cracked machine

Whisked away on one awesome, blissful journey through sound after just one listen of their debut album, I, Cosmonaut, Cracked Machine have been mentioned and rightfully praised on Devizine over the last year. Formed in Wiltshire also, in 2015, local space-rock hypnotists, weaving “mesmerising grooves, infectious riffs and layers of sonic texture to create compelling and original soundscapes which take fellow cosmic explorers on an exhilarating trip through the cosmos.” This is Pink Floyd likened space-rock, meeting ambient trance for a new generation, yet their second album, The Call Of The Void, reflects a harder, rock edge, we’re talking Hawkwind here, and it’s reverie style will hold you spellbound.

 

Deemed the headline act, Cracked Machine is a quartet of experienced musicians, brought together in a quest for aural mayhem; Bill Denton on guitar, Clive Noyes on keys samples and vocals, Chris Sutton on bass and Blazej Gradziel on drums. They play the Southgate today, and are a welcome blessing to our local scene.

strangefolk.jpg

Vibrant retro-rock fusion with folk and neo-gothic, Somerset/Hampshire’s Strange Folk UK is one I’ve not heard of, and look forward to. The band’s roots are in folk, and distinct rock aspirations are tempered by a recognisable folk vein running through their songs to varying degrees. Dark impressive vocals ride the crest of a truly great sound that transports the listener to another time.

Quoting their influences may divulge that time; sixties psychedelic legends such as Dylan, Janis Joplin, T-Rex, The Doors, Free, Hendrix, and Jethro Tull, there’s mod influences too like The Who, and Genesis, and harder rock like Zeppelin and Judas Priest.

Between bands, we announce acoustic artists, Devizes singer-songwriters, Marland favourite Tom Littlefair and the brilliant Ben Borrill, topped off with a local funky soul DJ set from Usaf. I’m truly delighted to bring you this news, reckoning this is addition is going to really add a whole new musical dimension to this already fantastic gem on Devizes event calendar. As well as all of DOCA’s exciting circus, street theatre side stalls, rides and games, it now stands at two stages large, double the fun!

benborill

 

Oh, and I do believe Devizine has the exclusive on this one; expect a plagiarising Gazelle or Herod along any moment. Please feel free to share our posts, but if republishing them observe copyright and quote Devizine as the source; basic etiquette, thanks!

 

Adverts and All That Malarkey!

 

artsfestdevaveburyrocksmikjonsouthgatecavifesthauntedpostScooterRallyposterNovskittlesvinylrealm

Solstice, or What-Christians-Macallit?

Summer Solstice is on Friday 21st June and English Heritage provides free Managed Open Access to Stonehenge as usual, under the conditions: no amplified music, no drones, no alcohol, no drugs, no drunken or disorderly behaviour, no camping, no sleeping bags, no large bags, no chairs, fires, Chinese lanterns, fireworks, candles, tea-lights or BBQs, no glass, no sharp or pointed objects, and, of course, no climbing on the stones; something we’ll return to in a bit.

You will be searched, and anything deemed unsuitable will be confiscated, other than that, have fun.

I appreciate this reasoning, our nanny-state concludes you are not to be trusted; you should be immune to this concept by now. Have no concern, they will create common sense for you and write it on a fluorescent signpost.

With workshops and bands, there’s a four-day pay-festival; setting you back £125 to camp per person, £325 for a campervan pitch, or £490 for glamping. Yet through a pastel illustration, its rather deceiving website shows an idyllic festival with the ancient monument just a hedgerow behind. What may be the closest festival to Stonehenge for Solstice, is actually over two and a half miles away in Winterbourne Stoke. That said, I believe they bus it up to the stones in time for sunrise; road closures and traffic jams worked in, I’m hoping.

Cashing in on our desire to recapture ancient ideologies is not exclusive to this festival, English Heritage hides the hiked-up parking charges in small print, on another section of their website, away from the main Conditions of Entry page. Hardly surprising, after last year’s dispute, the opposition headed by the Loyal Arthurian Warband, and as Titular Head and Chosen Chief of what has become known as The Warrior/Political arm of the modern Druid Movement, Uther Pendragon.

Devizine spoke to Arthur last year, when the heat was the parking charges. Seems English Heritage will not compromise, while it costs tourists just a fiver anyother day, on the one day guaranteed to pull a crowd of homegrown visitors, they triple the tax. Deemed a “pay to pray” policy, Arthur persists on this mission. The most bizarre twist in this fiasco is this year’s EH website designers, who’ve decided to use a picture of St George slaying the dragon to advertise. One may appreciate the reasoning for rules, but the reasoning for using Christian symbology to advertise a pagan feast? The only possible explanation I conjure is it’s a veiled satirical stab at Arthur, who declared, he is one dragon they “will not slay.”

The notion they’re suggesting Christianity should convert solstice is so absurd I blocked it from my mind. Yet, I was shocked at what research churned up. Despite the impossibility of Mary, with child, travelling across Israel, and shepherds off -season during winter, Christian websites maintain Jesus was born at Christmas, and that the sun mimics the death and resurrection of him. If the idea the Earth’s solar orbit never occurred until after the birth of Jesus isn’t a hard-enough pill to swallow, they now continue to suggest summer solstice is actually St John the Baptist’s birthday bash.

Justified by the verse of John 3:30, declaring, “he [Jesus] must increase, but I must decrease,” this reflects the sun at the summer solstice trailing its forte, while the winter sun gains, it is no new theory, however outlandish.

Is this what’s happening now, I shudder? Are English Heritage supporting the idea that summer solstice be replaced by a Christian celebration, or just condescendingly mocking Arthur? Is the winter solstice (Christmas) and the spring equinox (Easter) not enough for them? The final nail in the coffin for ancient faiths; here, have Beltane too while you’re at it. Perhaps they think, I ponder to myself, that if solstice was Christian no one would attempt to climb the stones, as you’ll never see the congregation of Salisbury Cathedral drunkenly jeering on daredevils halfway up the spire!

It’s what it all boils down to, this ill-conceived stereotype of pagans; those wild and reckless heathens. And, if I’m brutally honest, clambering up an ancient monument that you’re supposed to be worshipping, while bits of crumble beneath your muddy CATs is the only part of the ritual which bothers me. I did ask Arthur how he felt about this in our interview last year, he didn’t get back to me prior to its publication, but did afterwards, and here’s what he had to say:

(There’s) “not nearly as many ‘climbers’ as there were, and this little tale is how and why,” he said. “A few years ago, there was a ‘climber’ and the guy in front of me was yelling ‘get off the bloody stones!’

‘That’s rich coming from you’ I said, ‘you were up there last year!’

To which he spun around and very indignantly said; ‘No I wasn’t, that was the year before.’

In fact, he had been pictured atop of the stones in the Guardian, which is why I made the remark, but think about it; the first year he’s up there, the second he’s not and by the third he’s part of the ‘self-policing’. Like I say, they may come for the wrong reasons, but they return for the right ones.”

So, if the druids strive for an awakening in us, may be the Christians could accept paganism has its place in modern society. The Earth is really what we need to worship after all, in this era of looming ecological doom. Our ancestors could teach us a thing or twenty about conservation.

Radical I know, best we can hope for I guess is a peaceful solstice at our county’s most famous landmark, try our best to ignore just why EH would choose Christian symbolism to represent a pagan feast. The mind boggles; hope they don’t fall off of our flat Earth!

But, as a wiseman once said, for want of a peaceful solstice, try Avebury. The National Trust website has the details for this slighter, more tranquil solstice gathering, and takes a far less religious approach in its design too! The car park will be open from 0900 on Thursday 20 June 2019. Parking here is £7 all day (0930 to 1830 in summer) £4 after 1500. Motorbikes can park for free, but the carpark gets full very quickly. NT advise public transport, which is doable from Devizes, Marlborough and Swindon.

There is no on-road parking in Avebury itself or Beckhampton, West Kennet and Winterbourne Monkton. The villages are patrolled regularly by Traffic Enforcement Officers and if you park illegally you may be fined or even find your vehicle is removed. Silbury Hill car park will also be closed overnight during this period.

The only campsite in Avebury has only space for under 100 tents. It opens at 9am on Thursday 20th and closes and must be cleared by 2pm on Saturday. You can camp for free, but don’t forget to have a valid parking ticket, and no dogs unless they’re assistance dogs. Other official campsites nearby: Postern Hill Caravan & Camping Site, nr Savernake Forest – 0845 130 8224 or 01672 515195 http://www.forestholidays.co.uk Blackland Lakes, Calne. 01249 810 943 http://www.blacklandlakes.co.uk or Bell Caravan Park and Camping, Lydeway nr Devizes, 01380 840 230

Me? Oh, I’ll be working on solstice; I’ll stop to see the sunrise, probably between Lavington and Urchfont somewhere; despite I see it every morning and never grow tired of it. Might even take a tea-light with me, stick that in your pipe and smoke it EH!

 

Billy Green 3; Should not be Moved

On my holibobs last week, local Geordie Britpop/mod musician Bill Green of trio Billy Green 3, (not to be confused with the British-Upper Canadian scout who saw victory at the Battle of Stoney Creek, naturally) messaged a YouTube link to his debut single, “I Should be Moved.” Promised to get on it this week, finally made it; procrastination rules, but glad I did.

Impartial towards Britpop, it’s not Marmite, I take it or leave it. In my defence, during the era rave was the thing, Madchester just a slice and not a principally progressive slice when compared with breakbeat. To shock horror of Oasis fans, I sauntered past them on the NME Stage at Glasto 94; never heard of them, never cared to; I was hunting hi-tech party vibes, not a Beatles tribute.

I try to decipher if my appreciation of the genre has matured, or if it’s the forceful sixties-mod element which, while present in Britpop generally, seems particularly prominent in Billy Green 3’s style. The words and riff echo a Britpop classic for catchiness, studio noise and tambourine intro and, especially, the chorus though, rings the simplicity of sixties mod. With the modern component of a perfectly placed sample, the circle is complete, Samuel L Jackson’s one-liner as Pulp Fiction’s Jules Winnfield completes it. “Sounds great, Bill,” I replied after a tinny listen on my phone’s speaker, because it does. Grown on me more, now I’ve got it on loud.

If anything, the magnitude of this slick three-minute ride spurs me bookmark Billy Green’s next local gig, though none listed yet; watch this space. Meanwhile I wanted to gage Billy about what the recording side equates to. “I assume it’s an original song,” I asked, “written by you?” and fired several other minor questions all at once, at least England was one-nil up…. at that point.

“First recording with the new project, me and a young lad called Harvey Schorah on drums, backing Vox and all-round vibes,” Bill replied. “I wrote the words and music, played guitar, bass and sang lead and backing vocals. Martin Spencer [The Badger Set, Potterne] produced. He’s a magician, essentially, he took the song in my head and made it come out of the speakers; just love this creative process in addition to the recent live shows.”

On what this will spur, Billy explained, “second song in mixing as we speak, and then hopefully will work out how to put them out as a mini EP.” Posted on their Facebook page today, we may get a listen to it, Lose Our Way, at 7pm.

Drafting my next question, for the review lead us onto football, I mouthed my thoughts that England are sitting back on a 1-0 and then, oh dear (or words to that effect!)

billygreen31

“Brilliant,” Billy added, “the review, not the football, they were poor on the first half apart from the penalty, still time though; being a Newcastle fan sometimes optimism is all you have!”

This fell appropriately onto my last question; does Bill think Newcastle had a scene during the Britpop era to rival Manchester?

“Prior to Britpop I think,” He suggested, “later 80s, there was a label called Woosh, my mate’s band, the Nivens were on there and ran on Flexi discs. There’s a retrospective out called C87 which was named after the NMEs C86, but a couple of decades later, they’re on there, so jangly guitar pop; the Nivens actually opened for the Smiths. Club nights at the Broken Doll and the Riverside, basically was my musical apprenticeship, introduced me to so many great bands. Moving into the 90s, there was more of a grunge scene with Cranes etc, now there is a resurgent drone scene with a hotel in Byker putting on Japanese noise artists, it’s a bit bonkers.”

“Bonkers could describe any current pop scene in the UK though,” I scoffed.

“Fair point,” Bill nodded, “Alan McGee doing his bit for guitar bands with the Creation23 label, and This Feeling are putting on some good nights. I work in London a bit, so have been to a few of their club nights. Met up with the now defunct the Shimmer Band from Bristol, who I thought were destined for great things. DMAs came out of that scene, from Australia, and are now heading festivals, think Shame came up through there, my mate’s band Free Money are booked in, they even did the last Lexus ad, which is a bit mad. I guess I’ll always be a fan of the get a group of mates together and play in a garage until someone notices you route.”

Well, that’s been the ethos for many a decade and never did the garage scene of the sixties any harm. Stuff the Simon Cowell karaoke TV show fiasco, Billy Green 3 is archaic in fashion, just enough to know the score, yet fledgling to fit into the burgeoning music scene here; I think “I Should be Moved,” puts a stamp on that; take a listen and decide for yourself.

 

Adverts & All That!

queenspartyquizconsartsfestdevwelbeingjonsouthgatemikericerniededicoatskittlesaveburyrocksonceupontimehauntedpost

Legally Blonde Jnr Comes to Devizes

You got into Harvard Law?

What? Like, it’s hard?

Hey, get your flaxen Barnett around this; Legally Blonde, rom-com, chick-flick adaptation of Amanda Brown’s novel of the same name is eighteen years old. Yeah, like, I know right. Two years later they made the sequel; although a smash at the box office, it never raised a reviewer’s eyebrow, banally crashing the blonde versus brunette joke which Archie Comics carried for over seventy years.

Yet the initial movie stands the test of time, I like it and chick-flick generally isn’t my thing; lack of spaceships blowing things up, see?! The foreseeable gags enhanced by Reese Witherspoon’s amusing characteristics, at a time when The Spice Girls’ run of “girl power” was fading. Challenging the blonde stereotype with comical narrative was a peg in female equality and certainly the break for Reese; ummm, Reese Witherspoon…… where was I? Oh yes, female equality.

legallyblondehead

Like many trailblazing films, it received a theatrical reworking by 2007. Premiered on Broadway, Legally Blonde had an efficacious three-year-run at London’s Savoy and picked up many awards. Now, directed by Oliver Phipps and Hayley Baxter with musical direction from Naomi Ibbetson, it has found its way, least a “Jnr” version, to our own Wharf Theatre.

Legally Blonde Jr. The Musical opens at the Wharf Wednesday 24th July, runs until Saturday 27th (7.30pm each evening with a 2.30pm Saturday Matinee) and promises to be pink: “The Musical is a fun and sassy journey of self-empowerment and expanding horizons, with instantly recognizable songs, this show will leave cast members and audiences alike seeing pink!”

Plot being, if the film passed you by: The Delta Nu sorority president, Elle Woods, seems to have it all; good looks, a relationship with the campus catch and a great taste in clothes. However, her life is turned upside down when her boyfriend, Warner, dumps her to attend Harvard Law School. Determined not to lose him Elle uses hard work and a fair degree of charm to get a place there herself so that she can prove she is serious and win him back. Whilst there she tackles stereotypes, snobbery and scandal but she also makes some great new friends along the way and gradually discovers how her new found knowledge of the law can really help others.

With music and lyrics by Laurence O’Keefe and Nell Benjamin, again it’s a rousing and prevalent choice for the delightfully quaint Wharf Theatre. Tickets, £12 with under 16s £10, can be purchased from Ticketsource, at the Devizes Community Hub and Library on Sheep Street, or by ringing 03336 663 366. To find out what else is on at the Wharf pick up a Spring/Summer brochure which is available from the Community Hub and Library and many other outlets around Devizes.

 

Adverts & All That!

ericernieartsfestdev

queenspartyquizconscarwashwelbeingskittlesaveburyrocksjonsouthgatemikdedicoatonceupontimehauntedpost

PREVIEW – White Horse Opera sing Gilbert & Sullivan’s “The Mikado” – Saturday 15th June @ St Mary’s Church, Devizes

A Bit of Nanki-Poo in The Vize

By Andy Fawthrop

 

Do you like opera? What about “light” opera? With rather a lot of comedy thrown in? Good – because you’re really going to love this!

Last night I was privileged to attend the full dress rehearsal for “The Mikado” by the splendid White Horse Opera company. I was expecting something perhaps still a little rough round the edges, maybe the odd fluffed line, the occasional note or cue to be missed, but there was really none of that. The company had been rehearsing for months, had chosen their principals carefully, and were absolutely up for it.

Yet again – another gem in the entertainment crown of Devizes – we are so lucky to have these people doing this stuff!

mik3

This particular bit of nonsense, a “comic opera” in two acts, with music by Arthur Sullivan and words by W.S. Gilbert, their ninth of fourteen operatic collaboration, opened in March 1885, in London, where it ran at the Savoy Theatre for 672 performances, the second-longest run for any work of musical theatre, and one of the longest runs of any theatre piece up to that time. Since then it’s been translated into numerous languages, and is one of the most frequently played musical theatre pieces in history. The setting is Japan, an exotic locale far away from Britain, which allowed Gilbert to satirise British politics and institutions more freely by disguising them as Japanese. And the company has done an excellent job of the now-traditional exercise in updating the lyrics of some songs to reflect politics Britain in 2019. Particularly pointed was Ko-Ko’s (The Lord High Executioner’s) song about who he’d like to execute (“I’ve got a little list, and they’ll none of them be missed”).

mik1

It’s always difficult, and sometimes a little invidious, to pick out individual performances but I think it’s worth mentioning particularly Graham Billing, who delivered a hilariously nervous and dithering Ko-Ko, Charles Leeming as a wonderfully pompous and self-important Pooh-Bar (Lord High Everything Else), Lisa House as Yum-Yum, and the resilient Ian Diddams, playing The Mikado splendidly as a power-crazed modern dictator. But there were strong performances all round, from every member of the cast. It was so obvious that they were thoroughly enjoying what they do, delivering a top-notch production.

I’m not going to give the plot away, nor would I even attempt to summarise the complicated ins and outs leading to the hilarious denouement – suffice to say that the story is stuffed with disguises, mistaken identities, the fickleness of emotions, and the usual human drivers of fear and greed. The main characters ham it up splendidly, and deliver the songs with confidence and panache, squeezing every last drop of comedy out of the script.

mik2

Given that it’s performed in modern dress, sung in English, and is a laugh-a-minute, it’s completely accessible and enjoyable. So, even if you thought that you didn’t like “opera”, I can assure you that you are going to love this. Thoroughly entertaining stuff!

It’s going to be performed on Saturday 15th June at St Mary’s church at 7.30pm. Tickets are an absolute bargain at only a tenner, and are available via Ticketsource or the company’s website at
https://whitehorseopera.co.uk/

mik

Future productions by WHO include:

• Wednesday 30th Oct to Saturday 2nd November @ Lavington School – Bizet’s “Carmen”
• Tuesday 17th December – venue TBA – Christmas Concert
• Friday 20th March 2020 – venue TBA – Spring Concert

And if you’re interested in getting involved yourself, whether singing, playing or behind the scenes, just head over to their website. You can also support them by becoming a “Friend” of the company for £20 p.a. Remember – they are an amateur company, supported by volunteer efforts and by voluntary contributions from their supporters.

 

Adverts & All That Malarkey!

artsfestdevqueenspartyericerniededicoataveburyrockswelbeingsaddlequizcons0941596001555518913_all stars flyerjonsouthgateScooterRallyposterNovhauntedpostonceupontimevinylrealm

Reggae, Reggae, Reggae, in…. Devizes Arts Festival?! Barbdwire Bring a Taste of Coventry to Town

All Photos used with kind permission of Gail Foster

 

feat2

From a talk by CBE award-winning English foreign correspondent and BBC News world affairs editor, John Simpson, to the Sub-Organist at Durham Cathedral, Francesca Massey, the Devizes Arts Festival has kicked off this week, better than Tottenham. Their showcase, more varied than ever before, truly caters for all; you just need to either research, or hear me bashing on to find something suitable for you.

Personally, my time came Saturday, when the Corn Exchange was blessed with sweet, sweet reggae music! You know I love thee, local music scene, but my ongoing quest to encourage more reggae in these backwaters came to an apex last night.

5

Perhaps a hard sell in Devizes, yet a genre I’ll push until the wheels fall off. Yep, said wheels won’t last to shove Devizes into the streets of downtown Kingston Jamaica, but our great hall was lively and the modest audience appreciative of what Coventry based Barbdwire delivered.

Without doubt Barbdwire could produce a “beginners guide to reggae,” without watering down or succumbing to commercialisation. For all sub-genres were presented to us last night, with tremendous panache and sublime competence.

4

I often wonder how irritated Ziggy Marley gets when interviews adopt the cliché angle of his father, recollecting him once stating, “reggae is not a one-man-music, it’s a people music.” An apt quote for Barbdwire, the band a varied bunch. While originator and drummer, Trevor Evans, the former Specials roadie-once drummer, characteristically oozes a reggae archetypal, bassist Chelly’s persona rings out dub and the proficient trombonist has Two-Tone band written all over him, trumpeter John Pudge, clearly the youngest, doesn’t appear represent any reggae stereotype.

feat

I snatched a quick tête-à-tête with John, attired in a T-shirt embossed with “Roots, Rock, Reggae,” I was keen on querying his t-shirt gainsays against his instrument choice, brass sections being generally considered ska-related. We discussed how Barbdwire play to the audience; their ability to pull any of reggae’s subgenres out of their hat makes the band flexible, supporting The Specials, as their next gig, or Holli Cook, as they did last week.

3

But centre of attention last night in Devizes, this band were an epiphany for some residents and a universal accreditation for those reggae lovers. In our preview I said, “(Two-Tone) may have challenged punk with chicness akin to mod, but today, these subcultures are inconsequential, we can bundle it all into one retrospective burlesque, select whatever element of any we care to, and fuse them without pretence or offense; one reason why a group like Barb’d Wire is fresh and electrifying.”

 

Well, while reproducing their album Time Has Come’s originals did just that, their choice of covers was equally extensive. From ska favourites like Baba Brook’s version of Herbie Hancock’s Watermelon Man and the Wailer’s debut hit Simmer Down, they also exposed the audience to roots, with Max Romeo’s Chase the Devil, Horace Andy’s Skylarking, renowned for his later work with Massive Attack, and even dub, akin to its master King Tubby.

2

There were versions of reggae classics, like Uptown Top Ranking, and all harmonised by the beautifully melodic and confident vocals of Cherelle Harding, a singer who could roll on a lovers tune with the finesse of Phillis Dillon to convert without haste to toast a stepper’s riddim, at one point verging on dancehall with a wonderfully luminous interpretation of Sister Nancy’s Bam-Bam.

Make no mistake, this diversity was not delivered reggae-lite, rather an expertise and rounded acknowledgement to the many faces of Jamaica’s music export, and delivered to us adhering to all the positivity and joyfulness the genre celebrates. As an apt example, they gathered outside to meet and greet, where they were applauded with respect vowed to add our town to their tour map; something I’ll hold against them, as this was an outstanding performance!

6

Long live the Devizes Arts Festival then, hopeful they’ll consider the evening a success and plan in, as they are already planning 2020, something else reggae-related. Following on, this week sees Strange Face at The Bear today (Sunday) where the Adventures with a Lost Nick Drake Recording takes place.

Monday and Christian Garrick & John Etheridge presents Strings on Fire at The Exchange. Tuesday is The Shakespeare Smackdown, and Wednesday String Sisters are at St Andrews Church.

An Audience with Bob Flowerdew at the Town Hall, also Wednesday, and Thursday, Atila Sings the Nat King Cole Story at the Town Hall. Oh, and next Saturday has a whole host of FREE fringe events across town. Check the website for booking details, but hurry, Friday’s Moscow Drug Club event is sold out. If cancelations occur find posts on the Arts Festival Facebook page, and I’ll promise to share them as soon as I spot them; have a great festival!

You Can Help Liam?

Liam is the most caring and loving boy that unfortunately cannot live a life of his dreams.

 
He nearly lost his life three days after his birth when he suffered Hypoglycaemia and associated brain injury. Liam was treated for severe sepsis and as a result of this trauma he now suffers from multi-focal epilepsy, global developmental delay and is also visually impaired. He has difficulty communicating and moving about safely, therefore he has special educational needs.

 
Now 6 years old, none of the medications he’s prescribed for his epilepsy have helped him in any way, they make him feel nauseous, restless and agitated. Even with four years of continual medical review and dosage titration there has been no improvement in Liam’s health.

 
Recently his family discovered there may be another hope for Liam. they found a medical doctor in Egypt that specializes in healing brain injuries by combining medical and holistic approaches. She’s had many successes in the past 35 years helping children with epilepsy and other neurological conditions, who similarly, had no other options left.

 
Liam’s family would like to raise money to take Liam to Egypt to undergo this treatment. The treatment involves daily visits to surgery, injecting supplements, adjusting diet and lifestyle advice that will attempt to regenerate Liam’s brain and hopefully help him to live a more fulfilling life.

 
Liam’s mum from Devizes, Martina Pangrazzi is a single mother with two other children, the cost of the treatment and taking time away from work while having the means to care for her other two children while she is away is overwhelming.

 
Can we get their campaign to required £7,000? Can you help Liam? Give what you can here.

 
Martina would greatly appreciate any help; it will make a huge difference to Liam’s life. In her work, Martina helps people overcome their anxieties, depression and stress, but unfortunately, she cannot help her son, and needs your help. “This seems to be the only option we have,” she said.

 

Adverts & All That!

Barbdwirededicoatqueenspartyaveburyrocksjonsouthgatewelbeingericernieonceupontime

Twit Twoo: Owl Fest Announce Line Up

Breaking and brilliant news as Adam Dempsey pings over the line up for this year’s Owl Fest on Saturday May 25th in Bromham’s social club, The Owl. Chained to that kitchen sink again, I dried my hands on a tea towel quick as I could to reply what a fantastic line up, I reckon it is. He thinks it’s their best yet.

 
So, no more suspense, and in no particular order, it’s that five-piece classic rock covers band, Homer. Citing influences as wide as The Undertones and Buzzcocks to Thin Lizzy, Steppenwolf and Red-Hot Chili Peppers to AC/DC, Homer’s been on the local scene since 2012. Frontman Pete Pig, Danny Silvers on drums and backing vocals, guitarists Paul “Winger” Weinling and Les Vegas, with Graham the crazy bassist, are sure to rock Bromham.

homer

Devizine favourite Jamie R Hawkins will be there, with acute and sentimental storytelling brilliance, Jamie never fails to impress.

m17

Everyone’s favourite, Mr George Wilding will also do his stuff. With natural ability and ease, astounding originals solo and with Wilding, George is surely Wiltshire’s imminent legend.

n8

And you must love tiny country-pop princess, Kirsty Clinch with her bountiful talent and energy.

54800212_1393620857446899_4156153725360013312_n

Malmesbury’s Corky also returns with his hilariously original brand of acoustic “scrumpy and western” agricultural hip hop, had me in fits of laughter before the cider even took its natural course at last year’s.

20180526_185458_resized

My wild card, The Gentle Crows appear; not heard of these guys, I confess, but acclaimed rock covers they promise with great reviews online to date.

 
Topped off with Trusler senior’s Funked Up duo with Mark Colin Jones, with their brand of eighties funky-pop-rock, not forgetting the great selection of ciders on offer, food, I’m sure you’ll agree, The Owl is worthwhile heading towards on May 25th. See our review of last year’s here, and see you there, I hope!

 
The day is FREE, but if you want to use the Cider bar, you’ll need a wristband and plastic glass which sets you back a whole £8, and includes two tokens; why wouldn’t you?!

 

Adverts & All That!

borntorumpresents1reggaenightost18thBarbdwiregrandesophiawoodland2badartsbarndancea4poster[3646]hauntedpost0941596001555518913_all stars flyer0036273001555519004_outdoor training poster 2019ericernieopendoorquizcurveballsaveburyrocksonceupontimeScooterRallyposterNovvinylrealm

Barb’d Wire and Corn Exchanging; Reggae Finds a Home at Devizes Arts Festival

Never content with what contemporary music thrust down our throats, even as a youngster, the easiest and sneakiest place to hunt for origins was Dad’s record collection. It would be years before he discovered the shortfall of vinyl and confronted me. Sixties Merseybeat and blues-pop standard, I recall the intriguing moment I unearthed a shabby cover of a girl’s naked torso, “Tighten Up Vol 2” was inscribed on her abdomen in lipstick. So, when he did, I inquired why he bought this, Trojan Record. More concerned where his Pink Floyd gatefold had vanished to, he half-heartedly explained, “it was something different,” as if he didn’t wish to divulge too much, “and cheap.”

bradtu

The estate of Bob Marley is still argued over, he never understood how to handle the royalties of rock star. Other than a BMW he had no extravagance, the house on Hope Road a gift from Blackwell, in which he lobbed a single mattress in the corner of a bedroom. What you see of the Jamaican music industry in the movie, “The Harder they Come,” is staunchly realistic; peanuts a too expensive commodity to compare to payments made to singers and musicians.

Poor wages triggered a prolific industry, hundreds of hopefuls jammed Orange Street awaiting to be ripped off. Trojan Records was founded the year after Bluebeat dissolved, 1968. The reasoning both English labels sourced Jamaican music was originally to supply the Windrush generation with the sounds of home, it is doubtful either realised the legacy they would leave. The underpaid nobodies singing on these records meant Bluebeat and Trojan could lower the price tag when compared to what upstarts like Bowie or Clapton would require, and price was everything for white British kids attempting to amass vinyl for house parties; as my father summed up.

bard5twotone logo

Though the attraction may’ve been the price, the enticement of these records came when the needle hit the groove; these rhythms were insatiably beguiling and exotic. I felt that ambiance too, and fell head over heels. But my palette had been preconditioned without comprehending it. Slightly too young to have immersed in the youth cultures of the late seventies, the sound bequest our pop charts.

Whether it was Blondie or the Police, or Madness, The Beat, or Piranhas, the charts of pre electronica eighties was inspired by the two youth cultures of punk and skinhead, and until the day I discovered a Bluebeat 7” of Prince Buster’s Madness, exposing Suggs and his Nutty Boy’s embodiment, I had no idea. Jerry Dammers’ Two Tone Records only had six years, an insecure contract with a get-out clause after one single, saw the acts achieve acclaim and jump ship.

Barbdwire

bard3

But if we celebrated Trojan’s fiftieth last year, we must do the same for Two-Tone’s fortieth, as it engraved its hometown, Coventry, as firmly on the ska map as Kingston. Within its short run Two Tone defined an era and reintroduced the roots of the dub reggae scene that punk spurred to white British youth; ska. The nonchalant rudimentary street-styled design of Two-Tone’s corporate identity is today considered standard ska practise; Dave Storey’s chequered monochrome background with Walt Jabsco, a character based upon a Peter Tosh image.

bard4tosh

It may have challenged punk with chicness akin to mod, but today, these subcultures are inconsequential, we can bundle it all into one retrospective burlesque, select whatever element of any of them and fuse them without pretence or offense; one reason why a group like Barb’d Wire is fresh and electrifying.

Though hailing from Two Tone’s home, Coventry, drummer and vocalist, Trevor Evans, a.k.a. ET Rockers, having begun his sparkling career as roadie turned DJ for The Specials, and with a brass section arrangement by Jon Pudge, ska is only an element of Barb’d Wire’s sound. Guitarist Ryan Every, Fingers Aitken on bass, and Mark Bigz Smith commanding the keys, blend influences as far and wide as punk to orchestral and blues into a melting pot of reggae. Fronted by the spiralling, gospel-inspired vocals of Cherelle Harding, their unique sound drives a heavy dub bassline, while not divulging on its preconditioned instrumental ethos. What we’re left with is a genuinely contemporary reggae lattice landing the group as firm favourites on the dynamic Coventry scene and festival circuit such as Skamouth.

 

While tracks like Duppy Town and Et Rockers Up Town, on their 2017 debut album, Time Has Come, rely on dub, a stepper’s riddim thrives throughout, but incorporates aforementioned influences. The only recognisable cover, for example, is the classic Latino-inspired Rockfort Rock of which the Skatalites perfected a ska-rhumba amalgamation. Produced by Roger Lomas, who also handles Bad Manners and The Selecter, again, Barb’d Wire pride themselves with Two-Tone influences, yet unlike the standard ska cover band you’re likely to get on our local scene, who all have their place in maintaining a clandestine but welcomed scene here, Barb’d Wire will be a fresh and welcomed gig, when they arrive at Devizes Corn Exchange on Saturday 1st June as a feature of Devizes Arts Festival.

bard2

For me, and any reggae/ska/soul aficionado, this is simply unmissable, but for the Arts Festival it may be a risky move, breaking their typical booking in search for newer audiences. While organ recitals, poetry slams and theatre noir have their place, we owe it to ourselves to support this event in hope it will spur future events at the festival of an alternative and contemporary genre. That is why you’ll see our Devizine logo proudly on the posters for this particular appearance, as though we plan to bring you more in-depth previews and reviews of this year’s stunning line-up, I’m most excited about this one!

 

Saturday 1st June: Tickets available now, £18

 

Adverts & All That!

borntorumgrandepresents1reggaenightost18th0036273001555519004_outdoor training poster 20190941596001555518913_all stars flyerericernieartsbarndancevinylrealmopendoorquiza4poster[3646]aveburyrocksskaingsheeponceupontimehauntedpost

What a May Day! Things to do This Month; Part 2

Hark, the darling buds of May. Already looking quite blossomy isn’t it? Well, blossoming too is stuff to do in and around our local neighbourhood, and a few weeks ago I presented you with a lengthy look at what’s on during the first fortnight; see here.

Now though, sit down and brace yourself for some shocking news. I have, actually produced the second part of the monthly preview, and here it is! Though promised with previous months, I tend to side-track, or just plain scatter-brain and not carried it through. Not so this time, you don’t have to thank me, unless you have a choc n nut Cornetto.

Week 3: Mon 13th – Sunday 19th May

Regular sing-a-long at Devizes Folk Club in the Lamb, Devizes on Monday, similar on Tuesday if your go to the Bradford Folk Club, 8pm in the Cellar Bar of the Swan Hotel. Meanwhile, St James Wine Vaults in Bath where Radical Westie Productions presents Daisy, Television Villain, Ravetank and Devizine favourites Nerve Endings; £3 door tax.

Wednesday 15th, and Peter Vaughan does pasta at Vaughan’s Kitchen Cookery School, later don’t forget the acoustic jam at The Southgate, Devizes.

There’s Bach Suites by Orchestra of the Age of Enlightenment: Young Artists Anima Fidis Quartet at the Wiltshire Music Centre Bradford on Avon.

Thursday’s is acoustic night at The Royal Oak, Corsham. Hannah Rose Platt and Black Sheep Apprentice at The Tuppenny, Swindon or tribute night with The Quo Experience at The Cheese & Grain, Frome.

artsbarndance

There’s a barn dance on Friday 17th at the West Lavington Hall. Usually wouldn’t make a song and dance out of such, but all proceeds go to the wonderful charity Arts Together; read about my visit, and the great work they do, here. Please support Arts Together, they’ve music, buffet, bar and raffle, see the poster for details. Future Devizine Presents nights will also like to donate to Arts Together.

smokedonuts.jpg

Sheer Music is back in Devizes, the Cellar Bar has Smokin’ Donuts; one-part Carter USM and t’other festival cult hero, Doozer McDooze. Brilliant indie-pop Talk In Code and the talented Jezilyn Martyn support. £7 advance from Sheer Music, a tenner on the door.

But if you thought Devizes was a one-gig Friday town, you’d be very much mistaken. There’s Johnny 2 Bad, an eight-piece boasting to be the UK’s number one UB40 tribute at The Cavalier Community Hall. Except the reggae train-spotter in me upheaves that Johnny Too Bad is actually by The Slickers and only covered by UB40, eh? Bit of reggae in the Vizes, though; never going to knock it. £10 in advance and should be great night.

2bad

It’s rather retrospective in the Southgate too, with sixties garage and Mod band, Absolute Beginners at The Southgate playing a debut in the town. Three-piece playing covers of songs by The Who, The Small Faces, The Kinks, The Eyes, The Creation, The Jam, Secret Affair, Squire, and The Purple Hearts.

Without a cinema, the Assembly Hall in Melksham shows movies, The Favourite is on Friday. Break Cover are at The Talbot, Calne. An Open Mic at The Pump, Trowbridge. Comedy Night at the Boat House, Bradford on Avon. Tensheds live at the Rolly in Swindon and amusingly named Antarctic Monkeys at the Cheese & Grain, Frome.

reggaenightost18th

opendoorquiz

Back on reggae for Saturday, although other events are available, it’s Devzine’s second gig of the month, a reggae and ska night at the Cellar Bar with Knati P and Razah and I’ll be warming up for them with a ska show live. Look, again I’m asking you to come along, listing door damage as a fiver but as long as you give us what you can, that’s good enough. For all the proceeds go to homeless charity, Devizes Opendoors. For want of a quieter evening Opendoors also have a Quiz Night from 7pm at Nursteed Community Centre.

Those Truzzy Boys play the Conservative Club in Devizes, £3 on the door, Drew Bryant at The Southgate, and Sound Affects support the Dusk Brothers at the Cavalier’s Ameripolitan Music Club. Meanwhile, The Wharf Theatre welcome back Hancock clone, James Hurn, with new scripts.

truzzy

Brother from Another at the Woodbridge Inn, Pewsey, and Woodborough Social Club has Humdinger. Blues Bros & The Commitments at Melksham Assembly Hall. Còig at the Wiltshire Music Centre, Bradford on Avon while the Neeld Chippenham has medium Derek Acorah.

Fresh from Montreal LG Breton and drummer Marco Dionne joins Phil Cooper for his Vise-Versa tour, closet to us is Saturday at the Village Pump, Trowbridge, other dates here: http://phil-cooper.co.uk/tour-dates

Sunday 19th sees the Chippenham Soap Box Derby and John Etheridge’s Sweet Chorus is at the Wiltshire Music Centre, Bradford on Avon.

Week 4: 20th -26th May

 

Devizes Folk Club down The Lamb on Monday, An Evening with Graham Gooch at the Neeld, Chippenham on Tuesday. Acoustic Jam at The Southgate, The Royal Ballet’s Mixed Triple Bill at Wiltshire Music Centre, and The Waterboys @ Bath Forum on Wednesday.

Thursday is Acoustic Oak night at The Royal Oak, Corsham. Boxing Day and All Better play Level III in Swindon, and Carus Thompson is at The Beehive. But if you ever doubted summer is on its way, the bank holiday truly kicks off festival season, with Bearded Theory’s Spring Gathering in W. Midlands, or most fruitfully funky and stunningly popular dance fest, Shindig starts in Bruton. Shindig Festival is a glorious mash up of a gig, a house party, circus show, comedy night, a wellbeing retreat and kid’s party. No main stages, just an arrangement of stretch marquees, so you can be in amongst it, or chill on the grass. Kids can learn to DJ, breakdance and urban art.

This crazy weekend sees Chippenham Folk Festival starting Friday, as does Lechlade Festival. With Salisbury Live beginning, and Frome’s R&B festival with Frankie Miller’s Full House at the Cheese & Grain, you’re spoiled for choice.

Back in Devizes, Friday 24th, Bob Drury pays tribute to Neil Diamond at The Wharf Theatre. Adriano Adewele, Gwilym Simcock and Jason Rebello are at the Wiltshire Music Centre, Bradford on Avon. While in Swindon, the Wyvern Theatre presents The Rolling Stones Story, Sheer Music has Press To Meco at Level III and there’s a Ska’mageddon at the Vic with SN Dubstation and King’s Alias @ The Vic, but for real roots adventurers, try RDK Hi-Fi meets Roots Inspiration @ Black Swan, Bristol. I’m steering clear of Bristol as there’s too much to list, but that one will go off.

Saturday then, the 25th. Long Street Blues Club celebrate the music of one of rock’s best-loved icons Paul Kossoff, with May Kossoff the band. A chilled but robust night is promised at the Southgate, with Nick Tann’s British folk take on Americana heartland traditions.

owlfest19
It’s also time for Bromham to host the second combined cider and music extravaganza, OwlFest at the Owl, obviously. Did this last year, loved this last year, although I’ve no line-up info for you, you can bet your Bromham dollar this’ll be great. Another to watch is Marland’s showpiece, Gladstonebury at the Gladstone Arms, Chippenham, expect Steve Morano, the Sweet Swing Trio, The Chicken Teddys and Burbank.
Loud soulful, happy vibes will come from The Pilot, Melksham where Big Mama’s Banned play. The Gimme Gimme Gimmes and Devizine favs, The One Chord Wonders are at St James Wine Vaults, Bath, Frome’s R&B Festival continues at the Cheese & Grain with Geno Washington & The Ram Jam Band.

The old English spelling of Savernake Forest, Safernoc inspires an intriguing event in Marlborough on Saturday too; “violin, voice and banjo music from the 16th century to the present day, world premiere of Paul Elwood’s Safernoc; a series of compositions for mezzo soprano Alice Simmons and violinist Tam Coates by composer Paul Elwood. Both Simmons and Coates live near the forest and both have found inspiration in the shadows of that ecosystem. The text by the composer is a play on trees and an imagined impression of Savernake taken from Dante, Bernini’s sculpture of Daphne transforming into a tree, and Mexican painter (Sister) Juana Beatriz de la Fuente’s, “The Tree of Life.” Admission £10, email contactamitytrio@gmail.com for tickets.

savernake

Alex Roberts Live at The Southgate on Sunday 26th, the wonderful Sugar Motown returns to the Three Crowns. While Dr Feelgood plays the Frome R&B Festival at the Cheese & Grain.

End of May, Mon 27th – Friday 31st

Proper West Country, it’s the Coopers Hill Cheese Roll at Brockworth on Monday, Frome’s R&B Festival has Nick Lowe & Los Straightjackets.

With Bandeoke at Chippenham’s Neeld and Jackie & Felix Byrne at the Bradford Folk Club, that makes up Tuesday, while Wednesday it’s the World Music Club at The Beehive in Swindon, and of course, an acoustic jam at The Southgate, Devizes.

You can Meet the Gruffalo at Hillworth Park in Devizes on Thursday 30th, for his 20th birthday, Devizes Books bring the books, with a trail around the park, a prize draw and guest appearances, should be fun for kids of all ages.

gruffalo

Acoustic Oak at The Royal Oak, Corsham and Jonathan James is Discovering Music at the Wiltshire Music Centre, Bradford on Avon, while tribute The Commitments Experience are at the Neeld, Chippenham and Gaz Coombes is at the Cheese @ Grain.

That’s the month of May done, Friday 31st the Brodsky Quartet are at the Wiltshire Music Centre, Bradford on Avon and Salisbury Live continues. Other than this, seems like a quiet Friday, save for the fact it’s time for the opening of the Devizes Arts Festival, I think it’s the best line-up yet, starting with An Audience with John Simpson at Corn Exchange. Check our preview of the festival here, and I will be highlighting some of the separate events as the month goes on.

More details of all events here are on our event calendar which makes up Devizine’s busy home page, but bear in mind this is not a exhaustive list, the calendar is updated (nearly) every day, so keep checking for updates; too much of it to continuously post to Facebook, you need to check in every now and then, or you might miss something you need tickets for.

Have a grand and blossoming May, it’s building up to a great summer ahead!

 

Adverts & All That Malarkey!

seendbbberborntorumgrandehopdogartsbarndancepresents1townband0941596001555518913_all stars flyer0036273001555519004_outdoor training poster 2019townfestaveburyrockssophiawoodlanda4poster[3646]opendoorquizericernieartsfestdevhauntedpostonceupontimevinylrealm

What a May Day! Things to do Next Month; Part 1

Now your Easter eggs are nothing but screwed up tin foil it’s time to look towards May, and what’s in store for us during this early summer month. Part one, let’s get the first fortnight over and done with.

 

Week 1: Wednesday 1st May – Sunday 5th

 

First day of the month is a Wednesday, so it’s the regular acoustic jam down the Southgate, Devizes, an open Mic at The New Inn, Semington or a live stream of the The Royal Opera: Faust at Wiltshire Music Centre, Bradford on Avon.

moonraker

Thursday 2nd jabs at your funny bone, when the Moonrakers Comedy Night sets into the Cellar Bar, Devizes. Ed Pownall presents headliner Sol Bernstein, returning after twenty-five years of semi-retirement, only playing nursing homes. He’s performed all over the world at venues including The London Palladium, New York’s Carnegie Hall, The Paris Olympia, Caesars Palace Las Vegas, and Scunthorpe Baths, but it’s at night clubs where Sol really comes to life. With opener, Craig Deeley, a finalist in Jongleurs Last Laugh competition, and an additional special guest, tickets are £10, available form: The Bear Hotel, Devizes Books, The British Lion, The Southgate Inn, The Vaults, and on-line at “We Got Tickets.”

Along with a Charity Quiz Night for the British Heart Foundation at The Owl, Bromham, Swindon’s masters of downbeat, slack indie and wobbly pop, the Flour Babies bring an acoustic set to The Tuppenny with support by Callum McLean. Meanwhile, Chapel Arts in Bath has Will Lawton & Weasel Howlett (feat Buddy Fonzarelli) with support by our favourite, Tamsin Quin; Devizine is the #officialtamsinquinfanclub

hopdog.jpg

The second ale, cider and sausage festival, Hopdog, at the Woodbridge, Pewsey, kicks off Friday 3rd. Three days of family mayhem for a £10 advanced ticket, £3 for 12+ and children under 12 free. You can camp, for £7, space is limited so please book early via email: woodbridgeinnpewsey@gmail.com Friday sees Grizzly & The Grasshoppers. Saturday: Bob Bowles, Brian Stone, Jazz Wrann & The Ruby Welts and Sunday, firm Devizine favourites, the Larkin boys will be with Fly Yeti Fly and Kit Trigg.

Another festival in Blandford starts, the Teddy Rocks, in aid of Children’s Cancer, with a tribute-based line-up: details here: https://teddyrocks.co.uk/

Over in Devizes, the family club has Hariana, the UK’s number 1 tribute to Ariana Grande, and rumour has it, Vinyl Realm will host another fantastic Drum n Bass night at the Lamb, unconfirmed as of yet. Melksham Assembly Hall boasts Jethro’s The Count of Cornwall tour, while the Neeld have Queen II, and Bradford’s Wiltshire Music Centre hosts the Orchestra of the Age of Enlightenment. But if you like it raw, the Back-Wood Redeemers are at The Royal Oak, Bath.

Star Wars Day, oh yeah, bank hols too, Saturday 4th May, it’s over to Urchfont, for the Scarecrow Festival; always a lovely family day, starts at 9:30 through to Monday.

borntorum

Saturday night in Devizes is about rum and reggae at the Wyvern Club, where Michelle and Stuart Field’s Muck and Dunder rum bar hosts Swindon’s finest SN Dubstation while you dip into forty types of rum, ah-ha me hearties, tenner a ticket from https://www.muckanddunder.co.uk/ or failing that, dependable The Southgate has the great Sunset Service, free as always.

Out and about, you only need to get as far as Seend for beer, yep, it’s that time again for the Seend Beer Fest, their 19th, they know what they’re doing; gawd blimey, Train to Skaville will be there; love them. Certainly, reggae filled weekend though, with The Bob Marley Revival headlining Melksham Townfest at the football club, with Falling Fish, The Decibelles and whaaaa???? Train to Skaville will be there too??; must be an express train. The Ultimate Stone Roses are at the Assembly Hall, over in Bradford on Avon the NYJO Ambassadors and Mark Armstrong are at the Wiltshire Music Centre.

townfest

Swindon has “kids for a quid” at the Swindon & Cricklade Railway, PinkMac at The Waiting Room and some groovy Disco Voodoo, with DJ Ashley Beedle at Baila Coffee & Vinyl.

Spring in the Park is a family fun-day in Warminster on Sunday 5th, or round up the weekend at The Southgate, with a band I’ve heard only good things about, The Astral Ponies. Swindon has the cool indie-sixties mod band, Six O’clock Circus at The Woodlands Edge, and Bath has Pigstock at The Pig and Fiddle; two stages, with Falling Fish, Pompadour, Cut Throat Francis, The White Lakes, Luna Lake, Jamie Watson, Eilis Tucker, and our own favourite, Mr George Wilding.


Week 2: Monday 6th May – Sunday 12th

 

Bank holiday innt? Those Devizes Lions have the May Day Fair in the Market Place, and Corn Exchange from 9am- 4pm. On similar lines as previous years, but in addition to trades and charities, a new class of stall is being introduced, for artisans who produce goods for direct sale to the public.

Sound Knowledge Marlborough are celebrating the holiday with a bang, with Frank Carter & The Rattlesnakes from midday in Club Thirty8, for a wristbands-only short set, after which they’ll be in the shop signing copies of new album ‘End of Suffering’.

Wednesday is acoustic jam at the Southgate. Thursday is regular Kinks tribute, Kast off Kinks  at the Assembly Hall, Melksham, but if you think there’s too many broken hearts in the world, head for the Cheese & Grain, yeah, yeah, I know; Jason Donovan.

Friday 10th sees Tom C Walker at the Long Street Blues Club, Teddy White Band returning to The Southgate, and legendary punk poet, Dr John Cooper Clarke at The Corn Exchange. English comedian and writer, Mark Steel gives contemporary rants with his Every Little Thing’s Gonna Be Alright show at Melksham Assembly Hall.

Sam Sweeney’s The Unfinished Violin at Wiltshire Music Centre, Bradford on Avon and Sharron Shannon Band & Seckou Keita at the Cheese & Grain, Frome.

a4poster[3646]

Saturday 11th start the day browsing the Stert Car Boot Sale, it’s Devizes Cancer Research’s grandest event, supported by Grist, please come and help make a difference to this invaluable charity.

presents1

In all actual fact, it’s a very charitable day in Devizes; yep, we’ve our first Devizine Presents gig at the Cellar Bar. If you like Larkin, then it’s a double-whammy, because while Fin and Sam will be there, it’ll be possibly the only place to see them both, separately, Sam with a newly formed band and Fin with cousin Harvey as the Truzzy Boys. If that’s not enough for you, The Hound on the Mountain, the incredible Jordan Whatley will also be showing off his new songs and Gail Foster I will be in charge of intervals with her spellbinding and, possibly, rude poems. It’s a fiver or whatever you can donate, in aid of Devizes Opendoor; so please come down.

Opps, UPDATE ALERT! Please see the poster above for a change in schedule, unfortunately Sam had to pull out, but every clown has a silver lifeboat, hurrah for sixties mod-rock covers band, The Roughcut Rebels, who’ve stepped in to save the day and will be sure to add an extra dimension to the festivities.

If my thing ain’t your thing, I might just forgive you, especially if you try the Devizes Town Band’s concert, “Greatest Love Themes,” which will be raising funds for Alzheimer’s Support at 7:30pm, The Corn Exchange. In a change from the traditional black, band members will be wearing some other colours to make the concert more dementia friendly. I can identify with this; my nan suffered this terrible ailment.

Some people living with dementia see a black mat or flooring as a bottomless black hole, which is understandably very scary. They can also see people wearing black as floating heads, because they cannot identify black clothes.

townband

Babs Harris, CEO of Alzheimer’s Support said: “People’s perceptions can change when they have dementia and it is fascinating to hear from some of them how they now see colours. It is so heartening that Devizes Town Band have taken this on board for their concert and taken this extra step to make their performance truly inclusive and dementia-friendly. It promises to be a wonderful evening of music and the bright colours will only add to the celebratory atmosphere.” Tickets are £7.50 and you can get them from Devizes Books, or online via www.devizestownband.com

 
Alternatively, Hip Route are live at The Southgate, and the brilliant Indecision at The Owl, Bromham.

 
In Marlborough The Skandals are at The Lamb and Room 101 are at The Bear. The Blue Rose Band at The Pilot, Melksham. London Mozart Players at Wiltshire Music Centre, Bradford on Avon, Operation 77 at The Woodlands Edge, Swindon. Martin Kemp’s Back to the 80’s at Cheese & Grain, Frome; take your own Rubix Cube.

 
For want a peaceful Sunday on the 12th the Marlborough and District Lions Club welcomes you to drive through the glorious bluebells at Westwoods, enjoy the Bluebells and help support your local Lions Club. This repeats again next Sunday.
Time travelling magicians Morgan & West present a jaw dropping, heart stopping, brain busting, opinion adjusting, death defying, mind frying, spirit lifting, paradigm shifting, outlook changing, furniture rearranging magic extravaganza at the Neeld in Chippenham Sunday afternoon, promising to be fun for ages 5 to 105.

 
That’s about it for the first two weeks of May, if you think it’s jam-packed you need to see the finale part of May’s what’s on article, which I’m working on now, okay – cut me some slack! But before I go, remember to check devizine.com regularly, as it’s updated, like, nearly every day, and you might well miss something.

 
Also, please shed my workload by letting me know about your event, or news stories; there’s only so much scrolling and clicking I can do. You can email your info to devizine@hotmail.com Tweet, message the Facebook page, or I now have a Facebook group called The Devizine Communications Group, to make it super easy to make me aware of your events and gigs and news and stuff, so use it, don’t abuse it, love it and get some free publicity for your efforts.

 
Most of all though, don’t whinge at me for omitting something if you haven’t actually told me about it, sounds bleeding obvious I know but you’d be surprised by that amount of people who do!

 

Hey, hey, hey; I have actually followed this article up, click the image to go to the rest of the month’s preview!

may

Adverts & All That!

abba26thgeorgewildingowla4poster[3646]0246075001556052475_plant-fair-poster-a4borntorumreggaenightost18thopendoorquiz0036273001555519004_outdoor training poster 20190941596001555518913_all stars flyerartsbarndancecurveballsgruffaloaveburyrocksericerniehauntedpostonceupontimevinylrealm

A Local Look at Knife Crime

Navigating my footing becoming trickier as guy-ropes criss-crossed my path midst the shadowy maze of tents, still I chased. For reasoning I need not go into, the pursued managed to grab two twenty-pound notes from my wallet, one of which I snatched back, the other he made off with. The fleeting moment had gone from bad to worse, at this huge, anarchic festival. Now I was alone, chasing this kid. He had encouraged me not to follow, threatened to “carve me up.” I doubted his word; “carve me up,” over a score?

The notion arrived at my frontal lobe when he abandoned escape, turned to flash a blade at me. It only registered once I was an inch away, and he took a swing with the knife, then, thankfully, I took heed of common sense; wasn’t worth twenty quid. I backed off; he ran. He got a note off me; sucks, but I kept my life.

Reminiscing this feels like a movie, you know, where the hero escapes with seconds to spare; utterly thoughtless to have taken it that far, there’s no reruns in real life, no alternative ending. I find myself contemplating the what ifs, in this era where knife crime is rife, so the media informs us. I stagger at the whole stupidity of it, worry for youth, in times of desperation, economic slump, taking to the streets armed is a sad reality.

To those who adopt this philosophy, look at my pitiful example of yore; you’re not a “playa,” not doing anything fresh, nothing gallant or outrageous, zilch “gangsta” pal, just foolhardiness you cannot, and will not see as such until you get wise, or on a hospital bed.

Least, I speculate, should think ourselves lucky in Wiltshire, where by comparison I believe the chances of being a victim of knife crime is way less. But how much less, and is it on the increase? What would happen to me if I was caught with a knife in Wiltshire? I thought I’d hassle Wiltshire Police’s PC Paul Woodbridge for answers. If you do take a knife out to play, maybe you couldn’t care less what the police have to say. Yeah, alright, you’re free to skip the interview part, but I beg you scroll to the conclusion under the line.

Now, the Salisbury Journal reported in January that Wiltshire is bucking the trend of increasing knife crime, and ours has gone down recently, The Swindon Advertiser ran a similar article, but back in April last year it reported precisely the opposite: “Stats show Wiltshire knife crime up 214 per cent in five years.” So, after an increase, it seems the rate is dropping locally. I asked Paul how this reflects on the knowledges of the police on the streets?

“I’m not sure where your stats come from but you may be referring to some PA figures released recently which show a hike between 2013 and 2018,” he explained. “If that’s the case then the explanation is that our recording of knife crimes has improved in that time along with more people coming forward to report such crimes, thanks to the increased publicity around this issue. Overall, our knife crime figures show Wiltshire is a safe place to live; the statistics show knife crime has dropped by 18% across the county in the past year (Sept ’17 to Sept ’18) but we won’t ever rest on our laurels, and will firmly deal with anyone who we find carrying a knife.”

knife3.jpg

The assumption is violent crime, particularly knife-crime is predominantly a city problem, how much better does our market towns like Devizes, Marlborough and Melksham compare to our larger towns and cities, like Salisbury and Swindon? “By the nature of population sizes,” PC Woodbridge clarified, “and generally speaking, smaller towns do not experience the same extent of crimes as larger towns and cities.”

Yet though I’ve been planning this article for a while now, only this morning a post on a Devizes Facebook group claimed their son was attacked by youth with a knife, and was cut across the face.

What would PC Woodbridge advise if you’re threatened with a knife? Or is this a no-brainer; I mean, I’d run, right? But what if you’re cornered? Does he think self-defence classes are a good thing? “As you said, the best advice is always to run and get help.” He continued, “get somewhere public where lots of people are, if possible, and call the police on 999. Self-defence classes are down to personal preference, but I would always look to put as much distance between me and the knife as I could.”

I wanted to gage PC Woodbridge on the wonky ethos of carrying a knife for protection, what would he say to those who do? “Statistics show that that those who carry knives are much more likely to be injured than those who don’t. Carrying a knife does not make someone safer and you will be arrested if caught with an illegal knife and not a good reason to be carrying it. You could then face time in prison.”

knife4

What about armistice in a town like Devizes? What would happen to you, what would be the process if you walked into the police station and handed over a knife? PC Woodbridge explained, “if you were to hand in a knife then we would take your details and provided there had been no offences committed, then it would be disposed of. Don’t forget in September last year we had a countywide knife amnesty as part of Wiltshire Police’s knife crime campaign, Op Sceptre, where up to 500 knives were handed in to police stations across the county and disposed of safely. We will plan other amnesties in the future.”

I asked him, what else can we do to raise awareness and promote knife crime safety? “Information and education are paramount. Our recent Op Sceptre campaign has been very successful. During a week earlier in March, we spoke to people and gave out leaflets to underline the message: ‘No knife, safer life.’ We also do a large social media and media campaign. Search for ‘Op Sceptre’ to see what was covered.”

“Op Sceptre may be over for now,” PC Woodbridge continued, “but our work doesn’t stop, we’re never complacent about knife crime and I want to remind everyone that we will respond to any intelligence and information given to us by the public; knife crime can affect anyone. We also continue working with schools and colleges to keep the safety and educational messages in the public domain.”

knife2
Wiltshire Police Website

 

So, that’s what the police said, but with all due respect to PC Woodbridge, and though I’m grateful for his time, I’d wager the ones we really need to reach out to have skipped past this, don’t care for the what the police have to say. So, I reply, okay, fair enough, for now, to hell with the police, it’s just me and you here talking, right? I don’t write like the standard press, out to make money. Readers expect an honest review, so I write from the heart. Take the start of this piece for example, journalists never open on a real personal incident, okay?

I know, understand and appreciate the world may’ve dealt you a shit card. Maybe your folks did a shit job at being parents, maybe you reckon this government are selfish, backstabbing bastards, and I’d say, yeah, you’re right, mate. Must be loads guilty for how crap your life is; but the thing is, it doesn’t matter who you’d like to point the finger to, when you choose to go out and take a knife, no one is to blame in that instance, but YOU.

It is your decision. If a government doesn’t want anarchy through poverty, why would it apply pressure through consistent service and educational cuts, when the magic money tree exists? I don’t know; maybe because it’s hidden in a walled garden. They pick it for funding war, bailing themselves out by buying votes, and lavish luncheons. I swear, it’s what they want you to do, takes the pressure off them. Channel your anger at them, see? By taking a knife to some kid who maybe dissed you out of tenner, may be shagging your girlfriend, or not paid you for that eighth, taking your frustration out on any Joe Bloggs, you’re playing into their hand. I’d even go as far as saying, alright, we live in the real world; bods mug each other off, and if so, if has to come to it, take it out with fisticuffs.

The vicious cycle is that you take out a knife, and they need to take out a knife, and she needs to take out a knife and everyone’s taking out a fucking knife. Break that cycle, or, simply, someone is going to get killed, if not you, them, but shit, you’re still gonna do time for it. That is pointless and damn right stupid.

Thank you to PC Woodbridge for his valuable time, I’m not one to say if this will make everyone stop and think about it, but if just one does, that’s one life saved.

 

Adverts & All That!

folddnbgeorgewildingowlabba26tha4poster[3646]borntorumgruffaloopendoorquizhauntedpostaveburyrocksericernieonceupontimevinylrealm

Made in Dagenham, Showy at Dauntsey’s

Under the circumstances perhaps the most thought-provoking character in the musical Made in Dagenham is wife of Ford Dagenham’s boss, Lisa Hopkins; through her own reservations about her plush lifestyle, the career-aspiring housewife convinces the female factory worker’s spokesperson, Rita O’Grady, that the campaign is one of sexual equality rather than a class struggle. When while the real Ford sewing machinists strike of 1968 did indeed trigger the passing of the Equal Pay act, the issue is quite clearly rooted in worker’s liberty too.

 
So, I bite the bullet and go against my principals, arriving at the prestigious independent school, Dauntsey’s, to watch The Devizes Musical Theatre’s production of Made in Dagenham on their opening night, yesterday. A private school who brazenly parades its charity status, aids a local primary school, does a few sports coaching sessions at others and then sails around the world on its private yacht. Yet the irony of a play with the theme of working-class struggle staged in this tax-avoiding loophole abiding school, which Theresa May pledged against in her 2017 Conservative manifesto, but soon after quietly dropped, seemed to soar clear over the heads of the audience.

dag2
And hey, who’d flunked it, the theatre there is rather luxurious in comparison to a comprehensive school hall. It served its purpose for this, rather splendidly arranged musical, which though received critical response, ending its run at the West End promptly, I enjoyed. Intrigue drew me to the performance, how one can produce a musical from this principled, true story based social-message film of the same name. That and the fact my upbringing lies in Essex, with roots from the East End, to the point of jaded memories of an aunt chasing me with a spoon of wobbling jellied eels.

20190411_155016
Yet it seems any movie is game for a musical adaption these days and for all that’s worth Made in Dagenham stages some apt, witty and intelligently written songs for the pivotal cast. The musical introduced some characters not in the film, of which the audacious bigot, cowboy Ford director was the most excruciatingly farcical, waving an electric guitar around like Peter Capaldi’s Dr Who car crash moment.

 
Though the script’s characters and content felt patchy at times, I loved the comical depiction of Harold Wilson, played brilliantly by Matthew Dauncey. It was almost pantomime-esque against the stern portrayal of Barbara Castle, acted equally radiantly by Laura Deacon. Yet the fourth wall remained bricked at all times. The moral as serious as the trade union’s dissolvement.

IMG_2724

Giving credit for its humorous components, my favourite by far was Rachel Ibbetson’s representation of factory worker clown, Claire; I guess it had to devote somewhat to the Essex girl stereotype. But mostly it remains ethically witty, rather than lambast a weak county pigeonhole. Though I felt the acting ability was varied, the aforementioned, plus lead roles of Lucy Burgess, Chrissie Higgs as Connie and Jon Paget were all fantastic in their acting and singing solos. A further credit must go to the children, Ivan Barter and Emily Noad, for their thoroughly convincing despair when the chips were down.

dag1

I did enter with intensions to jokily knock attempts at the Essex accent, and indeed many actors did purvey more West London pronunciation, yet trivial elements aside, I came out satisfied at a job well done. Particularly poignant was the orchestra, who played marvellously, if not overpowering on-stage dialogue at times. To nit-pick further, the production could have been tighter. The lighting felt limited, microphone moments of lapse, and severe feedback at times, we must overlook; this was presented as amateur dramatics at its best, and the motivation and love of the arts clearly shone through, to demonstrate a dedicated and worthy production. Yeah, box ticked my love, I’m off shopping in Chigwell, rightly portrayed as the San Francisco of Essex!

 
Made in Dagenham only runs at until Saturday, so I’d advise you drop into Devizes Books and hope they’ve still got tickets. Shows start at 7:30 with a 2:30pm Saturday matinee.

 

Devizes Musical Theatre

made in dage

 

Adverts & All That!

olivafolddnbgeorgewildingowlabba26thborntorumericernieaveburyrocksa4poster[3646]opendoorquizonceupontimehauntedpostvinylrealm

Orchestral Manoeuvres In The Dark: The Full-Tone Orchestra get Big, Bold & Russian

By Andy Fawthrop

 

Well – you can never say with any credibility that “nothing ever happens in Devizes”. Spurning the opportunity to listen to the Buddy Holly tribute in the Corn Exchange (even if just to watch Darren become young again), [I do read these Andy, just sayin’!- ED] The Duskers at The Southgate, and The Billy Walton Band at Long Street Blues Club, for reasons that may need to go forever unexplained, last night I found myself sitting in a church (yes – I know) and listening to a 48-piece orchestra. As you do. Something had happened to my musical sensibilities and I’d come over all classical.

The Fulltone Orchestra were in town, conducted by the wonderful Anthony Brown. The theme of the concert was “Big, Bold & Russian” and that was pretty well what we got. Culminating with Tchaikovsky’s splendid “1812 Overture” (complete with the sound of cannons firing – although no actual canons were harmed during the performance – and the crashing of cymbals), we were treated to several Russian pieces. Earlier we’d heard “A Night On The Bare Mountain” by Modest Mussorgsky, “In The Steppes Of Central Asia” a symphonic poem by Alexander Borodin, “Rhapsody On A Theme Of Paganini” by Sergei Rachmaninoff, and “Scheherazade” by Nikolai Rimsky-Korsakov. Quite a lot to get through, but the performance was excellent.

RUSSIANPOSTER

The acoustics in the church, with its huge roof-space, meant that the walls of the building fairly vibrated with the brass section in full flow, and the sound of the strings sailed up into the rafters. The noisier sections (famously referred to by Kenny Everett in his heyday as “the bash-y bits”) really took off in these surroundings. The quieter solo sections, however, suffered a little and tended to get a slightly lost at times. However, Dominic Irving’s pieces on piano really shone.

However, bearing in mind that that this is effectively a “scratch” orchestra, only brought together for this one night’s performance and after only about six rehearsals, and that this was the first time that all 48 musicians had been on the same stage at the same time, this was an incredible achievement. Our Tone had worked very hard to bring all this together in just a few weeks and, by and large, pulled it off with aplomb.

Two minor criticisms – it would have been nice to have a programme (so that we knew what we were listening to), and it would have been a good idea to give Our Tone a microphone – some of his introductions were lost to those of us at the back. But these little caveats aside, this was a great performance, a thoroughly enjoyable evening. It did exactly what it said on the tin – it was definitely Big, it was definitely Bold, and it was without doubt Russian!

We’re very lucky to have such an orchestra based in our town, and we really should get behind them and support them. Next up for The Fulltone is the Fulltone Festival in Devizes Market Place on Saturday 20th July, from 2pm to 10pm, where they’ll be giving four (yes – four!) concerts in one day!

fulltonenew

Adverts & All That!

made in dagehillegggeorgewildingowlabba26tha4poster[3646]olivaopendoorquizaveburyrocksericernieonceupontimehauntedpostvinylrealm

The Cellar Bar goes Subterranean with Falling Fish, Larkin and Clock Radio

Andy Fawthrop  is Getting Down & Dirty with Sheer Music’s Second Subterranean gig down the Cellar Bar last night……

 

These sessions are named “subterranean” because the venue is underground, and Sheer (yea, for it is they) have always represented and supported roots, underground music (geddit??). Anyhow, having missed Subterranean #1, we were damned determined not to miss this one. Good decision – we were well rewarded with three great offerings.

Falling Fish were first up – a young band from Bath. Once I’d got over the shock of realising that none of them looked old enough to get served at the bar, I came to the conclusion it didn’t make a blind bit of difference, as this four-piece proceeded to knock of our some driving, dirty indie rock. Whilst admiring their chutzpah in turning the amps up to 11 (stadium level), I thought it might have been useful to dial the sound down a bit more to Cellar Bar levels. Still, once they’d finished blistering the paint from the walls, we got an extremely competent and tight set. Loud, proud, good stuff.

sub3

Local favourites Larkin were next up. Last time I saw Sam and Finley they were surrounded by other musicians at the launch event for their EP at the Con Club, so it was great to see & hear them deliver a more stripped-back set. This allowed the quality of their songs to shine through, and their playing to come more to the fore. They looked and sounded so much more confident. It’s great that they can play in both formats, but I think I slightly prefer them as a simple duo. They’ve got some good songs under their belt now, and it’s great to see them working on more new material.

sub1

And finally to the Grand Old Men of the evening – Clock Radio. And they didn’t let us down. A great, full sound, very much driven by the intense drumming of Gary Martin. Some fast and intense material, with a good, tight delivery. Last time I heard them was a couple of months ago at The Southgate, but the Cellar Bar as a venue seemed to suit their sound a lot better. They looked as though they were letting themselves go, and really enjoying the experience.

sub4

Went home one happy bunny – but it was a great disappointment that more people didn’t turn out for the gig. Such a shame that the promoter goes to such efforts to assemble such fantastic line-up, and finds three bands prepared to deliver some great performances, only for the Cellar Bar to be half-empty. If you weren’t there, you missed a great gig. Please support future gigs and live music! Come on Devizes – you can do better than this!

And just a word to the management of the Bear/ Cellar Bar – it’s bad enough only having Waddies excuse-for-beer without serving the stuff in flimsy plastic glasses. Not a life-enhancing experience!

 

Adverts & All That!

buddyhollylivesknati6tha4poster[3646]curveballsopendoorquiz51777752_2012580512128525_7993299459184263168_naveburyrockssaddlebackfriolivaericernieonceupontimegeorgewildingowlmade in dageborntorumhauntedpostabba26th

Stunning Guitar Work from Sunjay @ Acoustic Oak, Corsham

By Andy Fawthrop

Nothing ventured, nothing gained. Continuing to pursue my recent policy of getting out of The Vize, especially in the earlier parts of the week (when there’s not so much going on musically in town), and to explore the outer regions of the known Wiltshire Universe, it was time to bite the bullet and rock up in ye olde market towne of Corsham, specifically at The Royal Oak in The High Street, for Acoustic Oak. This is a club that operates every Thursday night at 8pm, mostly running open mic nights for anyone who feels like turning up. The clue is in the title –pretty well anything acoustic goes. This means folk, blues, singer/ songwriter, poetry, whatever. The first Thursday in the month is usually a “plugged-in” night, where it’s OK to turn up with a personal amp if you think you need one.

This Thursday, however, was a bit different. It was guest night, and we went to check out the hugely talented Sunjay. This 25-year-old already has a wealth of experience under his belt, having picked up his first guitar at age 4, and never having seriously put it down since. He’s been playing gigs, festivals and tours for the past few years. In 2017 he played Chippenham Folk Festival, and in 2018 at the Devizes Festival of Winter Ales. Perhaps more significantly he spent the first three months of 2017 playing the lead role in a national tour of Buddy Holly & The Crickets. In his own words he got the part “not because I could sing a bit and play a bit, but because I was tall & skinny and wore glasses”. Nothing could be further from the truth – he got the part because he’s bloody good! And he can still knock out just about any Buddy Holly number you care to mention at the drop of a hat. “Rave On” was tonight’s audience choice. To seal those Buddy performances he released an album entitled “Sunjay Sings Buddy” in late 2017.

Having played Acoustic Oak last year, this was a welcome return visit. And he was rewarded with a packed house, who absolutely loved what they saw and heard. To put it in a nutshell, Sunjay is a really good singer – but he’s also a phenomenally good guitar player. I saw two or three guitarists I knew in the audience, each of whom is pretty good in their own right, and these guys were watching Sunjay’s fingers with their mouths dropping open. Using no PA, just the power of his voice, his playing style, and a two-foot square of MDF for percussion, Sunjay took acoustic presentation to a new level. This guy is nothing if not versatile. Mixing tradition-steeped blues numbers, with modern pop and his own self-penned ballads, he kept the audience enthralled through two good hour-long sets. Veering from quiet, gentle blues and love songs, through to loud and fast, this guy really knows how to mix it up and how to truly entertain. Loads of textures and styles. And the whole was stitched together with audience participation, great personal stories, self-deprecating wit and a good line in jokes. A huge and well-deserved encore was a foregone conclusion, and I’m sure there would have been calls for yet more if we hadn’t been in danger of being kicked out of the pub. Great night and superb entertainment.

Sunjay’s tour continues through to the end of June, but unfortunately nowhere else nearby to D-Town. I’m sure he’ll be back though – he’s just too good not to. Or catch his great album “Black and Blues” from 2015 – you won’t be disappointed.

https://www.sunjay.tv/

Adverts & All That!

opendoorquizaveburyrocksolivaabba26thericernieonceupontimegeorgewildingowlmade in dagehauntedpostborntorum

You’ll be Broken-Hearted to miss Hannah Johnson

Howdy; yeah, it’s me, riding back to the crossroads on a horse with no name to convince you, once again, that your preconceived ideals about country music are not made of Spanish leather. Hannah Johnson & The Broken Hearts stroll into town on the 23rd March to cast this caboodle out to the desert. Not that we have a desert, but in a way, that’s my point.

deadkool

It’s easy to tire of the cliché of the modern country scene and arrive at the conclusion it’s not for you. Agreed, if you screech much of the music coming out of Nashville today denotes watered down country-pop, or stylistically pretentious Americana; same old chanted choruses and stomping drums, country music aficionado Dean Czerwionka, of Wiltshire’s Country Music Scene, Dead Kool Promotions aims to set the record straight.

Keen to promote and bring us all that is great about the scene, rather than the standardised churns of the industry machine, Dean hosts Hannah Johnson & The Broken Hearts at the Cavalier, Devizes on the 23rd March, with one of Devizine’s favourites, the Celtic-based acoustic duo, Sound Affects as support.

 

Surprisingly, it’s our homegrown artists reacting against this notion, and Hannah Johnson is of no exception, she’s from Birmingham. This award-winning (UK Country Artist of the Year 2018 – UK Country Music Awards and Most Successful British & Irish Single 2017, Hotdisc Country Music Awards) Brummie girl began her artistic career working in theatre and television as a child, participating in an unabridged version of a Midsummer Night’s Dream, playing Puck, aged 11, part of a Central Television actors’ workshop, and acting in national children’s TV shows. But ‘tired of being someone else on stage’ and hailing from a musical home, she began singing, and initially studied the clarinet, but switched to guitar in her teens; realising she couldn’t use the clarinet to back up her vocals.

She soon found a home with the country music genre, through its “humility, simplicity and ability face emotionally complex topics,” not forgoing fifteen years touring extensively in the UK, Europe and the USA as lead in her family band, The Toy Hearts. Hannah’s composition The Captain remains the biggest hit for her family band, the song a testament to both her song-writing ability, and her fierce independence.

hannah1.jpeg

An Alumni of the prestigious IBMA Leadership Bluegrass program, Hannah returns to the UK after a whirlwind tour of Austin, Texas, with shows in London, York, Doncaster, of course her beloved Birmingham, and Devizes. Her debut album, Shaken rinses of country and honky-tonk of yore, with characteristic twangy telecaster riffs and a singing style to make Tammy Wynette blush. With a slight smoky element of Patsy Cline to her voice, the standout tracks are her own compositions, receiving warm reviews.

An event then to warm country fans, and perhaps, ideal to introduce newcomers; you may be the broken hearted of her band title if you miss this one. This event is FREE, waddies, rustlers and cowgirls.

 

Adverts & All That!

 

vinylrealmfamilydiscolittle genevapostSpring concert POSTER 2019. C.indddecontonicposterbuddyhollylivesknati6thmade in dageborntorumonceupontimeScooterRallyposterNovstove1

Snakes in a Museum

Yes, it’s a cross between Night at the Museum and Snakes on a Plane, except neither Samuel L Jackson or Ben Stiller will be there, neither any real snakes, which may be no bad thing. This is Devizes, home to the wonderful Wiltshire Museum, where two snakes have slithered up the outside of the Museum building! The snakes were made by Wiltshire Young Carers at a workshop held in the Museum during February half-term.

mus.jpg
This Secret lives of Snakes, family-friendly exhibition opened yesterday. No real snakes, but the exhibit contains lots of interesting facts and details about these fascinating creatures. There’s lots of wonderful photographs, skeletons and taxidermy to highlight the world of these secretive creatures.

snake_514114-edit-958x848

Interactives for children include a snake trail around the Museum. Also, relating to the exhibit, the Saturday morning club for 7-14-year olds, Young WANHS have, “Sssnakes …” – snake-themed craft activities for on 9 March, from 10.15am – 12.15pm. There’s no annual fee, but pre-booking is essential to help the Museum plan the sessions. Each session costs £5 per child.

snakes1x5332

Then, on Tuesday 16th April, there’s a Jonathan’s Jungle Roadshow for younger children, suitable for age 4 and over. Children will have the amazing opportunity to find out about, handle and touch a diverse selection of fantastic live animals, including snakes. There are two sessions, 10.15am or 11.30am, each one lasts an hour and is again, £5. Accompanying adults free. Booking is essential as it’s only 15 children per session.

snakes2x533h3The exhibition runs until 28th April, normal Museum admission charges apply, but children and WANHS members are free. The Museum is now open Monday to Saturday – 10am to 5pm and Sundays – noon to 4pm. Bank Holidays may vary, check their website.

 
Yes, there’s stuff for the grownups too, such as lectures; Identity and Ideology during the Beaker period, by Chris Carey, University of Brighton on 30th March, is the only one not sold out. But none of them have got snakes in them! Where’s the fun in that?!

 

Adverts & All That!

 

stove1Spring concert POSTER 2019. C.inddlittle genevapoststonemountaindecontonicposterbuddyhollylivesmade in dageborntorumvinylrealm

Wiltshire Council Welcome Proposed Road Signs

Since a Wiltshire Council highway engineer advised Devizes Town Council that a sign at the High Street junction with Long Street is not big enough or in the right position last week, the highway engineer has been around our area suggesting other improvements which must be enforced for safety purposes.

 
Devizes Town Councillors were warned people might not spot the present ‘No Entry’ sign, and that it needs to be 600 CMs wide, wider than the road itself. “Maybe even larger, the bigger the better,” said a Wiltshire Council spokesperson, the one who really has the mentality to grasp simple English. “If it means we have to knock down a few historic buildings to make room, then we will.”

 
“We’d really favour,” the spokesman continued, “that the sign is lit with flashing neon letter-lights and overhead floodlights, twenty-four hours a day. Perhaps, it could also repetitively play a Bonnie Tyler song, or even the soundtrack to Rocky 4, to raise awareness of it too.”

 
“Devizes Town Council is clearly not accounting for the prerogative of speeding businessmen in BMWs belting through Devizes without a finger of fudge to road safety. They may have important calls to make on their phones, be preoccupied trying to locate a Starbucks, or generally too busy eyeing up totty to notice the clearly one-way street has standard no entry signs.”

 
The Wiltshire Council spokesperson, who cannot be named because their nametag fell out of their work jumper, because their mum didn’t iron it on well enough, stated, “those who think there’s no accounting for stupidity are wrong. One blast of ‘Eye of the Tiger’ or ‘Holding out for a Hero’ will alert the most insensitive arsehole; it’s certainly one of my favourite songs.”

 
With this apparent compete lack of competence of town councils to identify these issues, the Wiltshire Council highway engineer has proposed a new selection of signs be erected in obvious danger areas, using visual aids rather than a report, as he can only write in emoji.

 
Devizine has received these exclusive graphic representations for residents to swoon over in delight. I asked the Wiltshire Council spokesperson if he thought they were slightly aesthetically intrusive. “No,” he replied, “I think athletes will love them too.”

stonehengesigndevizes roadwhitehorsesignsilburysiignwelcometomarllongbarrowricksteinmarketplacecounty hall

Adverts & All That!

little genevapoststoriesSpring concert POSTER 2019. C.indddecontonicposterAsYouLikeItmade in dageborntorumsadleback-blues-festival-logo-2019vinylrealmstove1

My Kind of Science Fair!

 

Virtual Reality

Throw on your lab coats and grab your goggles: My Science Fair 2019 is here!

 
For the eighth year running, on Sunday 3rd March from 10am-3pm, the Wiltshire Music Centre in Bradford on Avon will host the free family event My Science Fair. The annual Fair, which attracted over 400 visitors last year, promises a jam-packed programme, full of activities, presentations and performances designed to engage young people aged 5+ years in the amazing worlds of music, movements and science.

my-science-fair.jpg
The day will begin with a bang as Bath-based Fun Science and presenter Cressida Bullock (known by her scientist alter-ego ‘Chemical Cress’) take to the Centre’s Auditorium stage for an interactive experiment with colour, excitement and fire. The Fun Science team will also be conducting roaming experiments throughout the day around the Centre!

 

This opening performance will be followed by a percussion workshop exploring the fast-paced rhythms of samba music with music leader David Garcia, who will be putting a scientific twist on the vibrant dance music genre. Later, electro-acoustic composer Duncan Chapman will be recording soundbites from My Science Fair attendees to create an enthralling lullaby, complete with the swooping and ethereal sounds of the Theremin and the haunting vocals of an Indian raga singer.

Supriya Lullaby MSF

 
Elsewhere around the Centre, children can look forward to creating their own plastic models with a 3D printer from the University of Bath or blast off with water powered rockets out on the field. Explore the exciting world of electricity with a Van de Graaf generator in a hair-raising experience, or discover the science behind the music we hear with sonic crystals. Experience a Colourscape installation where you are able to create sounds and digital imagery using your body movements or explore far-off worlds using a virtual reality headset. Budding engineers can check out the LEGO robotics stand, as well as Bot Club, where you can create your own mini-robots, and find out how to use ultrasound to levitate solid objects with University of Bath students.

 

QUESTION MARK GIRL
The Fair also marks the culmination of the My Science Fair competition, for which students from 14 primary schools across Wiltshire and Bath have been devising their own exciting experiments exploring music, movement and science. Experiments will be exhibited throughout the day and will be judged by an expert panel, including scientists from the University of Bath, University of Bristol and the University of the West of England, as well as automotive-test specialists AB Dynamics, the Ministry of Defence and Unilever.

 
As you make your way around the Centre make sure to visit the experiment stands to find out about their investigations, which explore questions such as “Which ingredients are important in a cake?”, “Is it possible to make butter using a bike?” and “Classical or funky music – which is best for sleeping?”

Duncan Chapman Lullaby
My Science Fair is being generously supported by the Bradford on Avon Area Board, the Jack Lane Charitable Trust, NFU Mutual and Wiltshire Music Connect, as well as Wiltshire Music Centre Season Sponsor AB Dynamics. Entrance is free and there is no need to book tickets. Simply bring your enquiring minds and join in on Sunday 3rd March to investigate, discover and create!

Colourscape1w

 

SUN 3 MARCH 10AM-3PM
Wiltshire Music Centre, Bradford on Avon, BA15 1DZ
TICKETS: This event is FREE to attend. There is no need to book, simply bring inquiring minds on the day and get ready to discover something amazing!

TIMETABLE:
10am-12pm: Fun Science Experiment, Samba Science with David Garcia
12.15pm-2.30pm: Lullaby Recording and Performance with Duncan Chapman
2.30pm: Prize Giving for Young Scientists
All Day: LEGO Robotics Workshops, roaming experiments, Colourscape, virtual reality, Bot Club, water-powered rockets, Young Scientists’ Experiment tables.

 

MSF Robots banner

FOR MORE INFORMATION:
Visit http://www.wiltshiremusic.org.uk/mysciencefair

or call the Wiltshire Music Centre Box Office on:
01225 860 100

Colourscape

FOLLOW, LIKE AND SHARE:
Using the hashtag: #MyScienceFair2019
Twitter @wiltshiremusic
Instagram @wiltshiremusic
Facebook @WiltshireMusicCentre

 

 

Adverts & All That!

stove1mikeowlstonemountainterryhen2019txtlittle genevapostbuddyhollylivesmade in dagevinylrealm

Kent Duchaine – Sunday 27th January @ The Southgate Inn

By Andy Fawthrop

“Great Lazy Sunday Entertainment!”

Dave & Debbie have done a really great job in putting The Southgate back on the Devizes musical map since they took over the pub last year, booking a wide range of great acts from Friday nights through to Sunday afternoons. These gigs are all free entry and, with a comfortable & welcoming environment and all beers at only £3 a pint, it’s a no-brainer to get one’s arse up there to enjoy the musical fare on offer. Sunday afternoons in particular have become one of my favourites – a view obviously shared by the local cognoscenti – for the place was again packed with happy customers.

This Sunday last we were treated to a fabulous session from Kent Duchaine, a man described by Mike Harding as “a legend in his own lunchtime and a REAL bluesman”. I use the word “treat” advisedly, as the man turned out to be one helluva all-round entertainer. Not only did he play some wonderful stripped-back delta blues on his 1934 National Steel guitar Leadbessie, he also connected absolutely with his audience. Every break between songs, every intro, every outro, the man was talking, talking, talking about his life, his travels, his experiences, his deep love of the blues, the music he loved, the blues players he had met an known. And not without a good dose of self-deprecating humour. It was an education just listening to the man. Fascinating. And what a voice! The guy obviously gargles with lumps of granite in his throat! Whether talking or singing, to hear him, (and to look at him) I guess you’d say he’s “well lived-in”, and a well-travelled troubadour.

kent2

Lots of Leadbelly, Muddy Waters, and all the rest of the great bluesmen, just flowed out of him all afternoon. Kent spoke and sang; Leadbessie drawled and crooned. The punters lapped it up.

Absolutely perfect laid-back blues for a lazy Sunday afternoon. Perfect entertainment.

If you’ve not been up The Southgate lately, time you checked it out!

Next gigs coming up @ The Southgate:

• Saturday 2nd February Drew Bryant
• Friday 8th February Clock Radio + The Jelas Live
• Saturday 9th February Tim Manning
• Friday 15th February Fake Walnut Dash
• Saturday 16th February Guilty Pleasure

 

Adverts & All That!

mikeowlstoriesbuddyhollylivesyoungdirectoryheader

rumreggaebassRRSweetsFvinylrealmruzzterryhen2019txtdecontonicposterstove1

In Review: The Bradford Roots Music Festival 2019

By Andy Fawthrop

 

Bit out of D-Town I know, but it doesn’t take long to just tootle over to Bradford, and the really splendid Wiltshire Music Centre. I mean – it’s not as far as Tibet is it?

Now in its seventh year, Bradford Roots Music Festival, now extended to three days, is all about two things – showcasing the vast array of musical talent that has any connection with Bradford, and raising (lots of) money for good causes. This year’s beneficiaries were Dorothy House Hospice, Zone Club (creative club for disabled young adults) and Wiltshire Music Centre. All the artists play for nothing and the event is administered and operated wholly by volunteers. That way all the funds raised go to the good causes.

So it’s a local (indoor) festival for local people. But this is not Royston Vasey, it’s Bradford.

And what a lot you get for your investment in a weekend ticket! I counted over fifty performances and workshops you could have attended if you’d really put your mind to it. I had to skip Saturday evening’s offerings (due to the small matter of Mr Wakeman’s KGB putting on a little show back in The Vize), but I still managed to sample more than 30 acts for myself. Once the WMC have given over the building to the Festival organisers for the weekend, the place is utterly transformed. Apart from four different performing stages (including the massive and superb main auditorium), there are several spaces given over to craft workshops, merchandising, tarot readings, a gin and prosecco bar, a main bar and an artisan fair. Just outside there’s a huge marquee hosting Hartley Farm Shop & Kitchen, which runs all weekend serving hot drinks and great array of home-cooked food.

But the music is the main thing. So many acts to choose from, and so difficult to highlight only a few from such a talented array of performers. But here goes: the stand-out acts for me (in no particular order) were:
• A Night In The Blind House – a rock and indie covers band
• Georgia Lewis – a stunning singer, multi-instrumentalist and folk artist
• The Hazir Ensemble – playing some stunning music from the Middle East & Turkey
• Lightgarden – original material from the UK, Russia and beyond, including Mongolian Overtone chanting (don’t ask – you have to hear it & you’ll be amazed)
• Rockpipes – a Bristol-based Celtic rock band featuring bagpipes (honestly!) as their lead instruments. Sounds mad, but it worked!
• The Bumnotes – an 8-piece acapella close-harmony group singing Barbershop

brdfolk1.JPG

Over three days I think I heard music from Africa, the USA, Crete, Turkey, Mongolia, the UK and – yes I know I said it wasn’t that far – even Tibet!! There was rock, blues, folk, country, bluegrass, barbershop, choral, jazz, singer/ songwriter, world – you name it!

The Festival is now over for another year but will be happening again next January. I can’t recommend this event highly enough – there genuinely is something for everyone to enjoy, with great food, great beer and a great atmosphere. It’s superb value for money and there’s plenty to do and see for children and for adults. If you’ve never been, I urge you to check it out for next year.

The Wiltshire Music Centre is also a superb venue in its own right, hosting a year-round programme of top UK and international artists from all genres – classical, folk, blues etc. Worth checking out if you are after top-class entertainment.

 

Adverts & That!

tamowlrumreggaebassruzzterryhen2019txtbuddyhollylivesaadamsvinylrealmstove1directoryheader

Soul Sucker

I am a bit, yeah, but I’m talking more about the debut EP from George’s band, Wilding…

 

Images by Nick Padmore

 

It was all going swimmingly in the wee hours of this morning, until I backed the milk float into a ditch. Wedged firmly in the bracken which now resembled a milk bottle tree, wheel-spinning, I sat slanted at the helm like a scene from the sixties Batman series with my head in my hands, soul in the dark; what a sucker.

 
Prior I was bobbing along, minding my own and all was fine and dandy. To add to my general satisfaction I’d Soul Sucker, the debut EP from George Wilding’s band Wilding ringing proficient vibes through my headphones and blessing my ears with its unique and curious composition.

 
Out today, I confirm it’s a foursome of awesome you’d expect from Mr Wilding, yet perhaps too fresh in my mind to make an exhaustive analysis; but here’s my best attempt; better, one hopes, then my reversing skills today.

n8

Everything about it detonates with George Wilding; his exclusive angle and unusual enchanting bearing, yet rings competent backing and expertise meticulousness the like we’ve been building to with Lunatic and Being Ragdolian. With a rearward melody at the introduction, Mouth Wide Open instigated pondering of post-punk, Siouxsie and the Banshees, but with a smoothed contemporary Velvet Underground developing and moving into a riff distinctly Stereophonics in fashion, with its everyday references to smoking at the bus stop, yet always, unquestionably, George Wilding.

 
The Other Side of Fence, dramatically and wittily lounges through like that Lazy, Lazy River with drunken swagger. Like Jim Morrison sliding over to the next Whiskey Bar, or finger-snappy, easy listening curve of Paul’s When I’m Sixty-Four while surrounded in Sgt Pepper’s psychedelic twirls and soundscapes, it’s equally refreshing and boldly different; blinkin’ marvellous.

 

Though maybe less experimental and free flowing then it’s previous neighbouring tracks, Slip Away is archetypical Wilding on form, current but nodding at nostalgia with the potential to plod into becoming a sozzled man-bonding, swaying-in-the-pub type anthem.

sad12

A delicate acoustic guitar riff, under ambient soundscape introduces the mellowed finale, Dirty Dream Balloon polishes this EP with a dreamy porcelain-doll-ballad, and, as is the rest, an experience beyond confines of “local music,” and into its own autonomous realm; in a word; it’s gorgeous.

 
It’s if Lou Reed could hold a note, its if psychedelia met Britpop, it’s a crumbly Flake chocolate bar spreading across your beatnik mum’s Meerabai sofa throw, no matter how much you try brush it off with unsteady hand, you cannot escape that its visible; this timeless EP will stain your music collection forevermore with a benchmark of creative genius.

 

Out today across all platforms: Bandcamp —– Spofity —– Amazon

 

Adverts and That

vinylrealmbrightoneerstxtChristmas poster 2018.inddeastertonxmasrobinsRRSweetsFstove1garthbrook

Birthday Bash, Birthday Bash….

Alrighty then, not to blow my own trumpet, it’s time to mention our Birthday Bash again; case you forgot! Concern that it’ll be just me, crying into a packet of pickled onion Monster Munch, and Dean trying to pinch one is waning, as attention for our little party grows evermore, like a zit.

 
While I’ve asked nicely if The Gazette & Herald would be so kind as to give it mention, being it’s for charity, and I’d thought that’d bury a hatchet, it seems I’m talking to a brick wall, so I’m relying on word of mouth, and Facebook of course; you know what to do, sharing is caring!

alflogowithsue.png

Oh, in addition, Sue Davis is going to ring me without inkling how grumpy I can be Saturday mornings, to allow my Dorset tones to ring over BBC Wiltshire radio-waves; I shall be live at 9:45ish. And of course, a special thanks goes to DJ Emma D, on the ones and twos at Fantasy Radio, who’s already given the bash a plug. While I’m unsure if she’d appreciate the tag DJ Emma D, I think it suits; make it a “thing!”

 
The best thing about it, this birthday bash I mean, other than we’re raising some Wonga for Cancer Research, is that all the acts playing were featured, or least fondly mentioned, back in the early days of Devizine, that long, long year ago.

Small - PNG-CRUK_AID_Pos_CMYK

There was one which hasn’t been mentioned, the wildcard, Dirt Road Diary, but unfortunately, they had to cancel. Suggested by Dean, as we’re in conjunction with Dead Kool Country Promotions, which basically equates to Dean doing all the hard bits while I sprout gobbledygook and take control of insuring the drinks behind the bar are suitable for you; I’m nice like that.

dirt road.jpg
I’ll be honest with you, (as you know I always am!) I had deliberations about a country band playing our gig, as it’s not to everyone’s tastes, until I downloaded their EP, “Our Country,” released Spring 2018. You can download it here from their website, free; it has that tender slice of rock, like Tom Petty & The Heartbreakers, particularly tracks like “Kiss Tomorrow Goodbye.”

 
While I’ve no plans to don a ten-gallon hat and rustle in cattle with a lasso, I love it, there’s a great many references to Americana, box-cars, highways, etc, which may seem cliched given Dirt Road Diary are from Calne, but its authenticity overrides this notion and it drives a convincing country vibe. “The EP’s been receiving great reviews,” lead guitarist Mark Allen tells me, “culminating with us being nominated for the BCMAs people’s choice award to be announced during the awards ceremony on the 24th November.” I don’t do hard feelings, and I wish Dirt Road Diary all the best with this and future ventures.

deadkool

Our Country certainly convinced me to change my mind about Dirt Road playing, plus it would’ve given certainty to the times here that I’ve mentioned the ethos the Devizes Country Music Club, recently renamed Devizes Ameripolitan Music Club, likely for the very reason that it is not as one might at first suppose; line dancing is just a slither of the scope on offer, and the club plays host to some experimental and interesting bands. Dean Czerwionka has also recently launched The Devizes Family Club, also operating out of the Cons Club, so as one busy guy, I’m extremely grateful for his time on our birthday bash project.

 
So, are we one act missing I hear you screech, am I down to ten men? Not likely pal, is the answer, as the wonderful Jamie R Hawkins has been on the warmup bench for the whole season, unsure if trips to Switzerland for his recording his new EP might disable his availability to join us, but I’m delighted to announce, he can do it! Adding Jamie to our bustling line-up of local talent really is the icing on the birthday cake.

jamie2

Have no concerns, we do have cake, a black forest gateau should arrive, made by the Harcourt Hamsters of Chirton, and kindly donated by Beverly Borrill; I kid you not, check out our hammie feature story from earlier this year!

ham5

Not forgetting Matthew Hennessy of Hennessyimages, who is our official photographer; as official photographer for DOCA and The Wharf Theatre too, provided he doesn’t upskirt me on the dancefloor, we’re delighted to have him.

 
With Dean, Matthew and Bev done, there’s so many others to thank, Carol and the Cons Club staff, of course, but especially Pete of our brilliant record shop and musical hub, Vinyl Realm, who’ve stepped in last minute to provide the PA, and hopefully operate too, as it’s way over my head.

vinylrealm

Most of all though, let’s thank the stars of the show, as no matter if I get my haircut for the special occasion or not, it’s not about me, it’s about the wealth of talented musicians who have kindly agreed to play for nothing but the love of their craft. Lottie J from Swindon you may well know; only fifteen with such a mature, soulful voice and keen writing ability. She’s one to watch, so get there at 6:30pm as she’s opening our show.

lottie

Our Devizes lads, Sam and Finley, aka Larkin are next up, you got to love ‘em; we’ve been following their progress through the brilliant Set You Free debut album to their new EP. After this then, I treat you to the masterful song-writing of that porkpie-hat-wearing Trowbridge living legend Phil Cooper, who sent me his album “Thoughts and Observations of…” to review many moons ago. Phil’s been working closely with our recent addition Mr Jamie R Hawkins, they bounce off each other nicely and so, I think we should extend Phil’s slot, slide said Jamie in and let them play in whatever formation they wish to; it’s a win-win.

lark5Phil

Tamsin follows Phil and Jamie, Devizine’s middle name is Tamsin-Quin-Fan-Club, our first ever article was about her crowdfunding project for an album, which came to fruition as Gypsy Blood, so it wouldn’t be the same without her here.

tamsinvrfeature

I’m also so delighted George agreed to come too, when I first met photographer Nick Padmore, he tipped me off about George Wilding, even prepared I was in awe of his natural ability, and I’d sing his praises to the moon and back, but they’ve probably heard of him there already. I have asked the amazing young painter, Miss Bryony Cox, who is also known for her love of singing, if she would like to join George for a song or two, appearing together in the past has proved to be a wonderful combination; not sure how far we got with this idea but I guess it’ll turn out whichever way on the night.

georgewilding

And what an awesome night it’s due to be, with Swindon’s The Day Breakers as a finale; Cath and Gouldy, who now also gig as duo Sound Affects, I first discovered through the Devizes Scooter Club as the then Killertones, with their awesome brand of classic covers we can all have a dance at the end; honestly, I insist. Dean has even offered, unofficially, to show us how to dance the floss – another good reason not to miss it.

bbq7

Of course, I might be persuaded to say a few words of gratitude, alcohol levels permitting, but you know I’m not best in the spotlight; has to be a very dull spotlight, 20watt or less. We do, however have the brilliant Devizes poet Gail Foster, to entertain us with some witty verses during any tuning and downtime from the acts, so a massive thank you also, to our Gail.

 
A few have asked if they can bring children, whilst I confess, I’ve not arranged provisions or entertainment specifically for the kids, of course they are welcome, and free for under 16s. Who am I to deny kid’s entrance, after all I’m a big kid anyway?! There will be balloons, provided by Cancer Research, and maybe, if I get the time, or someone else could bring some pens and paper, I’d be more than happy to spend as much time as I can on the night, doing some doodles with them.

 
Any other questions or queries you may have, do send them as I’m not an event organiser and probably have overlooked a number of things.

devizinebirthdaytextFIN.jpg

All I need now is you, oh and a buffet, which I’m working on, but no guarantees; if anyone would like to take this on, with the promise of free advertising on Devizine, I’d be enterally grateful if you get in touch asap. So please make sure you’ve had your dinner early, as it kicks off at 6:30pm, on Saturday, 10th November, and please come and enjoy yourself!

 
Tickets are £10, all proceeds, save a beer each for our acts, will go to the Devizes branch of Cancer Research. Get ticket at the club, at Vinyl Realm, online here, or message me if you’d like to reserve some, but there will be some on the door. Anyone on the guest list are welcome to donate to the charity if they so wish to do so, at the door.

Tickets Online Here

Let me know your coming on Facebook!

Advertisements

stove1ellesbailymurderchristmasexchristmasdsicoChristmas poster 2018.inddraftxmasbrightoneerstxtyoungmelk3

Reaction to Wiltshire Traction

Waiting in the bushes by the railings of the train station my adolescent friends and I would crouch. Timed to perfection, upon seeing the train coming under the bridge, we’d start running.

Our eighties equivalent of electronic ticket gates was a lengthy leg, wrapped in dark grey trousers. Said leg was attached to a stout, greying moustached Scotsman, who, from his ticket office would suspend it to reach the wooden planked wall at the other end of the corridor leading to the platforms, infectively creating an impenetrable barrier.

If judged just right, we could enter the station at speed, skid on our knees under the protruding leg, pretend we didn’t hear his aggressive howl nor see his waving fist, pray he didn’t take up chase, scamper down those cast iron stairs onto the platform, and board the train to Chelmsford seconds before the whistle was blown!

Witham_railway_station_20170609
There it is, the train station at Witham; very little has changed save the digital clocks, you can even see the road bridge in the background we used to hide by!

Looking back the risk was hardly worth the reward; Chelmsford hardly a utopian paradise, yet it was our nearest larger town and had amenities above our own; namely a cinema and Wimpy bar.

We lived around trains, marvelled at their abilities and played by the line; the highly dangerous “chicken,” or at less extreme times laying slow worms on the track and betting sweets on which one would make it off before the train crossed; it was our sadistic version of pooh-sticks. But our obsession with trains was entirely practical, unlike my elder brother, who for a short chapter in his life paid pennies, actually paid, not for a ticket to travel rather for a “platform” ticket in which he and his nerdy, anorak-clad mates would stand writing train numbers in a book; God, how I laughed then, still do today.

Trainspotting was real, unsure if it still is, until Stroud’s Amberley Publishing kindly sent me a book to review titled Wiltshire Traction by Mark Jamieson. To buy a copy would confirm.

I confess I was intrigued by the prospect of reading a history of Wiltshire’s railways, being while home of the GWR plant in Swindon, anyone from our area under the age of Dr Richard Beeching’s act of axing several main lines in the sixties, doesn’t share similar fond but mischievous railway memories as mine above.

20181023_150334_resized-e1540307120125.jpg
Trains; choo-choo!

So, there’s me expecting an informative history of the railways here, from days of steam to date; my ignorance at the term “Traction” in its title. For what it’s worth it begins as such, a brief explanation of Wiltshire’s landscape, agricultural and industrial trades in an extract taken from Bradshaw’s 1861 Handbook of Great Britain and Ireland. The introduction then mentions the existing main lines, and GWR works, but only breezes over past lines before rambling headlong into some serious train-spotter jargon about major freight operators and where they operate.

This is the fashion this photo-book continues on, ergo I’d wager the series, which are all ingeniously titled “[enter county name] Traction,” are much the same. With no text hereafter the two-page introduction, save a complex blurb detailing traction models, serial numbers and which line it ran on, to which a train obsessed fruit bat might view the series as a biblical, the rest of us would remain baffled and mind-numbingly bored with at the passing of the second or third photo.

20181023_150346_resized.jpg
More trains!

If you’ve only a passing interest in trains, as I, or you’re thinking “hey, maybe trainspotting might be a worthy hobby perusing,” I guarantee this book will put you off. You’d surely have to be a dedicated enthusiast to be entertained by this, but if you are, well then, buy Wiltshire Traction.

Perhaps I’m over-reacting but I’d like to have seen some narrative, what the trains meant to Wiltshire folk, how the Beeching Act affected their lives, what it’d have been like working at the GWR; all queries which could be answered with a visit to Steam in Swindon I suppose, yet this is a local book about trains I’d be hoping for, not an endless stream of similar photos of dirty trodden engines scooting through our green and pleasant land.

20181023_150354_resized.jpg
And yeah, you guessed it. I don’t know what else I expected from a book about trains.

All said and done, needles are in the haystacks (an endless stream of traction engines running on lines images) as in between the barrage of train-spotter’s wet dreams, there are a few photos which caught my attention; one of the Intercity 125 in it’s glorious retro colours, the D818 Glory being scrapped at Swindon’s works, a class 08 overhaul also at the factory, and the new Hitachi-built class 800 units at Swindon station, but that about wraps it up for fear of donning an anorak; you, though, might like it.

Wiltshire Traction by Mark Jamieson

Advertisements

stove1pelicanhallowescooteroctlittle shoprowdefarm3rowdefarm1devizinebirthdaytextFINkingcountryoungmelk3vinylrealm

Our Entire Area Becomes an Art Mecca with Marlborough Open Studios

Provided it’s large enough, I’ve been known to lose all track of time in an art gallery, and miss the last train home! But a gallery is one thing, this is another. July is Marlborough Open Studios month, the name of which in itself is quite misleading.

 
Although transport will help, a train to London is not needed, this is bang on your doorstep. The Open Studio concept transforms our beautiful landscape of the North Wessex Chalk Downs, which you know is breath-taking enough, into one massive interactive art exhibit, and something, well, quite unique.

 

open2jennypape.jpg
Jenny Pape

 
Beyond Marlborough, engulfing Calne to Hungerford, Wroughton to Chirton, a staggering forty-three of our finest artists open their studios and let you visit, to view their work in their own surroundings. You can meet them, perhaps their pets too, but I wouldn’t advise going through their pants draw like it was some tacky reality TV cooking show.

 
This is as far from a gallery as you can get and still remain in the world of art, but this is not a festival where you’ll be crammed into a tiny space with a million sweating, novelty back-pack-wearing young sybarites clutching bottles of water, all trying to dribble clichés over one painting. No, no, no; circulate at your own pace, use the website to check which studios are open, and visit at your leisure. There is no charge, just drop in when the studios are open; hence the name Open Studio, see?!

 

open3karrenjackson
Kareen Jackson

 
I guess you assess how formal you need to be by the greeting of each individual artist, but generally I’d imagine they’d be pleased to meet you. Artists, writers and creative people in general work in relatively solitude, twist their arm they might even put the kettle on; I might have to test this myself and get back to you on that!

 
So yes, Open Studios – July weekends: 7th-8th, 14th-15th, 21th-22th, 28th-29th. Check out the website here for browsing exhibiting artist as there’s too many to list here! The ones caught my eye are; beachcombing Kareen Jackson from Baydon, who transforms beach junk into unique hand-crafted driftwood boats, cottages and animals; so cute!

 

open4setevendavis.jpg
Steven Davis

 
Also, Mary Wilkinson in Minal, for her Turneresque local landscapes, Hungerford’s Jane Corbett’s other-worldly glass sculptures, stunning Devizes photographer Steven Davis, in Chirton Diana Neale’s dreamy mixtures of photographs and watercolours, or Jenny Pape’s beautiful oil landscapes, Sally Osborne’s crazy fish glazes in All Cannings, and there’s so many more, just browse the website to see!

 

open5janecorbett.jpg
Jane Corbett

 
Artists I’m well aware of but up for popping in to see too, are Bryony Cox, last year’s Bursary Award winner, who exhibits her paintings of vast skies over the Wiltshire landscape, Upstairs at Jacks in Devizes, and Anne Swan in Rowde who, with just colour pencils makes botanical studies you’d think you could reach in to the picture and take a bite out of!

 

open6byronycox.jpg
Bryony Cox

 
What a refreshing alternative to galleries, which you could take a whole month to peruse, at your own leisure, and not worry about missing the last train!

Marlborough Open Studios in July

Advertisements

saddlebackwellbeingdevizinead1newlogoherecomesgirlsposterstove1suitedbootedwithcredit300dpi[3515]outwest 18 bootsy remixfemalespeci2charitybbq