March On: Things to Do. Part 2

Everyone having a nice March so far, been alright, innit? I promised, when I featured the first fortnight of events, here, that I would return to complete the last two weeks. I’ve promised this before and totally spaced on it, for which I apologise; not enough hours in the day. Nothing to do with my goldfish memory. Here though, this month, I’ve actually only gone and done it, before the 31st March too! See below if you don’t believe it’s true, the last fortnight in March, stuff to do while waiting for the supermarkets to restock on bog roll, and all that. I know, it scares me sometimes too.

madmarch
Click on the hare here to see the first fortnight of March

Bear in mind, mind, our calendar is constantly updating, so do check in as more events and gigs are bound to magically appear like the shopkeeper in Mr Ben.

Week 3

Sunday 15th is where we were up to, and I got two fantablous gigs, Burbank are the White Bear in Devizes, while Jon Amor is at the Three Horseshoes in Bradford on Avon; nice.

Monday, I never know if the Devizes Folk Club is on down the Lamb or not, to be frank, but it’s a place for a beer if I’m wrong and it’s not!!

Tuesday 17th The Stonehenge lecture at the Wiltshire Museum is now sold out. Celebrated cartoonist and artist, Norman Thelwell is at The Merchant’s House in Marlborough, for a fascinating hour illustrated talk, tracing his life, passions and artistic development. Thelwell produced 1,500 cartoons and 60 front covers for the famed Punch magazine alone and some 32 books translated into a dozen different languages. His works were full of beautifully observed detail and mainly of rural subjects, including country and leisure pursuits, sport, house sales and renovation, stately homes, gardening and sailing. Failing that, Cracknakeel provides live music at The Sun in Frome for their St Patrick’s Day celebration.

Wednesday 18th is jam-packed, for a Wednesday! Acoustic jam down the Southgate, Devizes. Bromham’s Farm Cookery School has a Taste of Morocco class, where you could be learning how to make a Briouat which is like a Moroccan Samosa, make your own Khobz and Kefta Mkaouara. £40.00 per person. Over in Marlborough David Evans gives the second of three lectures in The Merchant’s House Study Series, focussing on Reformation in England and the Arts. The Roots Sessions continues at Frome’s Cheese & Grain with the fantastic Ruzz Guitar’s Blues Revue.

ruzz1

Thursday 19th and you could be back down The Farm Cookery School in Bromham for a Mozzarella & Halloumi Masterclass with Josie. She will teach how to make both cheese which is technical but fun! £35.00 per person. The fantastic Ed Byrne is at the Bath Forum and Moles has a punky/metal night with the Anarchist’s Bookfair, Butter The Pavement and Out Of Reach.

JCS_2020

If it’s a slow start to the week, Friday 20th March makes up for it. If, like me, all you know about Jesus Christ Superstar is that he came down from heaven on a Yamaha, and you have doubts with your conviction of that, it’s the opening night for this amateur production by arrangement with The Really Useful Group Ltd at Devizes’ Wharf Theatre. Tim Rice and Andrew Lloyd Webber’s classic musical portrayal of the last seven days of the life of Christ as seen through the eyes of Judas Iscariot runs until Sat 28th March and while tickets are still available as I write this, do be as quick, as if you were on a Yamaha yourself; take care not to skid though!

operaspring

Meanwhile Devizes Town Hall is the place to head for opera fans, as The White Horse Opera presents their Spring Concert. Including Donizetti’s L’Elisir d’amore, Ruddigore by Gilbert and Sullivan and Hadyn’s Creation, this would be the perfect introduction to opera for those, like me, who thought Donizetti was a type of pasta sauce!

melkfos

If you fancy music more pop, the local supergroup I’m always raving about, the Female Of The Species play Melksham’s Assembly Hall. Fusing all their respective band’s influences, expect the best of rock, soul and ska as the girl’s combine forces for a fun-filled gig; I’ve been to see one of these shows and I’m not hyping it up because they’re all awesome chicks, I highly recommend it!

shoeboxlogo

Day one of two, at the inspiring Shoebox Theatre in Swindon of their FUSE Festival where six emerging artists test a new performance idea over three days. Fuse is about supporting the beginnings of new work before it’s fully developed. Watch, discuss, and be part of the creation of something brilliant. Two performances Kat Lyons’ Dry Season, interweaving music and movement with original spoken word poetry and extracts from medical literature. And the debut one-woman-show from Mighty Mammal Theatre, Swine of the Times, where you can meet the piggies at the troff; they sing songs, say prayers and even mime. Alice Wolff-Whitehouse employs her skills in physical comedy, dance and song to bring to life a series of flawed and quintessentially British characters, looking at the grotesque nature of privilege in the UK through a warped and colourful lens.

Staying in Swindon, Baila Coffee & Vinyl have some Disco Voodoo with DJ Amir, or try indie rock covers with Joli & the Souls at the Vic. Elsewhere, the Leathers play The Three Horseshoes in Bradford on Avon, Clannad are at Bath Forum, and Jack Dee’s Off The Telly tour is at Salisbury City Hall.

Saturday 21st then. After the hugely successful free concert in the Market Place last summer, The Full Tone Orchestra have taken their show to Marlborough, and return to town to rave the night away at the Corn Exchange. Taking the most popular section of their show, the club anthems, expect this to be something innovative and all glowsticks, as conductor Anthony Brown’s beloved orchestra reproduce the club classics which defined an era.

The Cavalier go country with the Stone Mountain Sinners, caught these guys before, they’ve a refreshing approach to country-rock which is a cut above the rest. And breezy, original songwriter Ed Witcomb makes a welcome return to The Southgate. For surf beats, odd time signatures, eccentric tunes and irony-fuelled free jazz, try The Barge at Honeystreet, where bonkers surf surrealists Mustard Allegro do their stuff.

Super Trooper Abba tribute, Sensations grace the Seend Community Centre, while Swindon’s Meca has a Whitney Houston tribute. Don’t forget though, it’s day two of the Shoebox’s Fuse Festival too.

Mercy Lounge at The Three Horseshoes, Bradford on Avon. Recommended ska night at Warminster’s Prestbury Sports Bar with the Train To Skaville, and Paul Carrick is at Bath Forum.

Train to Skaville

Week 4

Head to the Southgate for an afternoon pint or three, on Sunday 22nd, and our fantastic singer-songwriter Vince Bell will entertain you. Meanwhile, Groovelator play The Three Horseshoes in Bradford.

ales3
Vince

Tuesday, Devizes Film Club at the Town Hall have the latest Ken Loach film, Sorry We Missed You, which you will be if you miss this one film fans. Full of drama, tension and heartbreak. Ricky and Debbie are the parents of teenage children. Ricky joins the ‘gig’ economy with a franchise for a parcel delivery firm. The job is sold to him as one where he will become master of his own destiny. Providing, that is, he complies with the labyrinth of deadlines, rules and conditions imposed by the company, a near impossible task. Debbie is a care worker who wants to care for the old people as though they are her Mam. But her working conditions thwart her in doing the job as she thinks fit. This modern Dickensian story dramatises the conflict between work and family life in contemporary Britain.

Don’t forget Wednesday’s acoustic Jam down the Southgate, and blues-folk singer Elles Bailey is with Phil King at the Chapel Arts, Bath. Thursday you can witness epic human-powered feats, life-affirming challenges and mind-blowing cinematography on the big screen at The Banff Mountain Film Festival world tour, coming to the Salisbury City Hall. Staying in Devizes on the last Thursday of every month though is no bore, as the regular and celebrated open mic night at the Cellar Bar is something to behold.

Seventies punk bands never had such a great name as Brighton’s Peter & The Test Tube Babies. Still going strong forty years on, they play the Vic in Swindon on Friday 27th. Tenner on the door. Swindon also has an Improv Jam at The Shoebox, and homemade function band Locomotion at the Swiss Chalet.

Locomotion

While it’ll sadly never be possible for the boys to be back in town, Preston’s tribute Twin Lizzy will. They make a welcomed return to the Cavalier, Devizes on Friday. Meanwhile, the Devizes & District Twinning Association take over the town hall to bring us some French Café Music with Jac & Co, tickets are also a tenner for both these diverse evenings.

How much more diverse do you want? A dedicated club night for adults with Learning Disabilities? This Is Me at the wonderful charity youth centre, Young Melksham is precisely that, a night of great music and friendship. There’s a series of these events, first one is Friday.

Another welcomed return to Marlborough Folk-Roots at the Town Hall on Friday, when Steve Knightley explores the themes and stories that inspire him and shows how music and words can become lyrics and chords and notes can meld to create songs that acquire a life of their own.

For want of an authentic tribute band, From The Jam play The Cheese & Grain in Frome, and I’ve heard all good stories about them. If originals are what you want though, The Queen’s Head in Box has a double-booking Friday. Katy Hurt stretches the country music genre in exciting new directions; haunting blues vocals, towering country rock guitars, even a reggae vibe, and she is followed by psychedelic alternative rock band, The Bohemian Embassy.

Saturday night of the 28th March is alright, but no fighting, please. Time for the Devizes Lions’ Spring Concert at St Andrew’s Church, where Ian Diddams comperes Bath Coleman, Bangers & Nash, and the Trowbridge & District Youth Band. Tickets are £10, proceeds to Wiltshire Young Carers.

The Corn Exchange has a Gin Festival. Tribute act, Motley Crude are The Cavalier and local heroes Rockhoppaz play The Black Swan. For high octane original and classic rock mixed with some tasteful Bluesy tracks, check the Mark Smallman Band at the Southgate.

Devizine is the unofficial Tamsin Quin fan club, if you wanna hear why, head to Bromham’s Owl on Saturday. Another Abba Tribute, Swede Dreams play Market Lavington Community Hall.

Tamsin Quin

Highly recommended for the mods, The Roughcut Rebels are at The Pheasant in Chippenham. Also, Blondie & Ska are great fun, they’re at the Wiltshire Yeoman in Trowbridge, checking ahead, they play in Devizes, at the Pelican in May. The Blue Rose Band at The Westbury Conservative Club and an Amy Winehouse tribute at Bath’s Odd Down AFC & Social Club. Level III have a “One Step Beyond-ska and punk club-night.

Elsewhere in Swindon, homemade Damm at Coleview Community Centre and P!nk tribute, Beautiful Trauma play Brookhouse Farm, and a Pearl Jam tribute, Earl Jam at the Vic.

Sophie Matthews explores the links between the visual and the aural in a one-hour presentation at the Merchant’s House, Marlborough. Drawing on the works of great painters including Brueghel, Hogarth and Rigaud, Sophie presents a feast of images featuring historical woodwind instruments in their original social context interspersed with live performances of historical music using authentic instruments.

Sunday 29th – Nearly there, and breath…. Yin Yoga & Gong Bath at Devizes Corn Exchange, The Sunday Sessions continue at The White Bear with Matt Cook and Gary Hall at The Southgate. There’s a Comic-Con at Bath Pavilion, to be frank, it’s a commercial affair rather than a genuine “comic” con, with cosplay, gaming and meeting vague TV actors and ex-Gladiators, but might be fun for the kids.

That’s it, folks, March done, save Bradford on Avon Folk Club have Geoff Lakeman on Tuesday 31st. Let’s regroup in April, but feedback on these articles are needed. Do they work for you? Long-winded I know, but in order to fit it in. Devizine is a work in progress, I enjoy and need to know what’s working and what’s not. So, if you’ve read this far, I salute you! Tell me about it!


© 2017-2020 Devizine (Darren Worrow)
Please seek permission from the Devizine site and any individual author, artist or photographer before using any content on this website. Unauthorised usage of any images or text is forbidden

Adverts & Stuff!

regmarlrevmarch14pelican2devvefin2final rowde ve day posterblondieskaborn to rumpelican1traintroy

Mad March: Things to Do. Part 1…

Huzzah, hurrah, hurray, whoop, bravo, hoot, shout, shriek, hosanna, alleluia and other synonyms for expressions of delight which I’ve shamelessly purloined from Word’s dictionary. Do I care? It’s March, time of the Mad March Hare, spring springing, birds a-singing in the blossoming treetops; after such a damp winter it’s refreshing to look forward to the April showers season!

Why do we even call them April showers when they tend to carry through from March to June?! Nevertheless, it’s warmer rain, with momentary lapses of sunshine, those little teasers of spring; don’t blink you might miss them. Still, just like a bear, I’m awakening from my hibernation, and heading downstream for a salmon supper!

In celebration of the feast, here’s some choosiest stuff to do over the coming month, as fished from our event calendar. The list is by no means comprehensive, you know the score by now, it’s updated (nearly) every day, so do try to keep up. Facebook is a good idea, if you do that, our page pumps posts out like Dwayne Johnson on a promise. Also, consider signing up for a weekly email, I don’t spam you, just once a week bulletin of what we’ve done and what’s to come.

First fortnight in March then, here it comes; the second half will follow…… I say that, then like a goldfish it’s a notion that’s gone in three seconds! Also, I can’t provide the links, but it’s all listed on our home page with links; it’ll take till April to do that, computer running at the speed of snail and all!

Devizes: First of the month is Sunday, nice way to ease into it. Georgina, Landlady of the White Bear, is running the London Marathon for Dorothy House, so there’s a pub quiz at 6:30pm to fundraise; £2.50 per person, max. 6 people on a team. Great Scott! St James Church hosts the monthly Devizes Silver Screen Film Club; Back to the Future showing this month. A great social meeting for our elders, and Driving Miss Daisy can provide transport.

silverscreen

If you’re looking for something wilder, The Three Horseshoes in Bradford on Avon is the place to head, where those Back-Wood Redeemers will be twisting those dark country and blues riffs into their splendid frenzy. Highly recommended from Devizine, tell them we sent you!

PSG has their regular Monday “Devizes session of Pop Soul & Gospel Choir,” at the Parish Rooms on Long Street, from 8pm until 9:30pm. Incredibly welcoming, PSG currently expect between 25 and 30 members on a Monday, and inform us “it’s a fantastic sound!” Join them for a fantastic start to your week!

Tuesday 3rd then, and it’s Devizes Film Club at the Town Hall. The Farewell (PG) from China, 2019. Director: Lulu Wang. To western eyes, this film has a curious plot but it becomes understandable in the telling. Billi has left China aged six, to be brought up in New York. Twenty-four years later, she is called back to attend a wedding that has been arranged purely to conceal from her grandmother that she is dying of lung cancer. Such kindly subterfuge is apparently common practice but Billi finds it hard to accept. She sees again many family members and it is her gradual reacquaintance with her Chinese heritage that provides this compelling, spiky exploration of family duty. A heartfelt, funny, emotional and rewarding film. The screenplay and production are wonderful, prompting The Irish Critic to call it the Best Film of the Year.

edgelarks
Edgelarks

Wednesday is the regular acoustic jam at the Southgate. Marlborough’s folk-roots club has Edgelarks at the Town Hall; duo Phillip Henry and Hannah Martin combine exquisite folk with influences as diverse as the blues and Indian classical slide guitar, to create a sound that is “subtle, atmospheric and bravely original” (The Guardian.) Alternatively, one of the most romantic operas ever written, La Bohème is showing at Bath Forum.

Even if not for the weather, Thursday 5th should get heated. Extinction Rebellion Devizes and Marlborough debate with MP Danny Kruger at St Mary’s Devizes.

Friday night in Devizes looks loud; hard-edged vintage blues with Barrelhouse at the Southgate will yowl like the Howlin’ Wolf. To contend, AC/DC tribute, Hell’s Bells play the Exchange, but want for a local, loud, classic rock cover-band, the awesome Homer play The Crown at Bishop’s Canning’s, and you’ll probably hear them from the Market Place!

buddy
Buddy Holly and The Cricketers

Lighter rock n roll tributes come from Melksham’s Assembly Hall, where you’ll find Buddy Holly and The Cricketers. Or Bath Forum has Elvis show, The King is Back, and Johnny Walker presents Sounds Of The 70s at Swindon’s Wyvern Theatre.

The 7th, first Saturday of the month then, here it is: A songwriter genuinely literate, sometimes almost literary, Ian Parker is an original craftsman. Expressed through a distinctive bitter-sweet vocal delivery, Ian’s songs hold nothing back. His ability and willingness to share with his audience, naked honesty and genuine emotion, is what sets him apart, and The Long Street Blues Club welcomes him and his band back. Meanwhile, a little more light-hearted, Teachers Pet Rock Show comes to The Cavalier Community Hall. If you’ve seen School of Rock, expect an East/West Midlands styled tribute, promising to be a “gut busting, face melting glorious rock show that’s suitable for all ages!”

regmarl

There’s acoustic fingerpicking, electric guitar thumping rhythms, harmonica and a loop pedal at the Southgate with Jon Pollard, while Marlborough’s Lamb has the high-energy classic rock covers band, The Electric Troubadours. Down t’other end of that enlarged High Street, The Wellington has its Welly-Fest; check their Facebook page as there’s stuff going on the whole month long. Comes to ahead for reggae fans though, on Saturday  when our friends Razah and Knati P bring their sound system; oh yes.

Tributes in Trow-Vegas with Abbamania at The Civic. Whereas it’s a Britpop tribute double-header at the Melksham Assembly Hall with Oasis Maybe and Ultimate Stone Roses, and always worth catching, The Blue Rose Band play The Talbot Inn, Calne.

Would you Adam & Eve it, Sunday March 8th is my birthday? Thank you, it’s just a number. Not spoiled for choice as I’ve only one gig listed at the moment, but I do love the White Bear, where Phil Jinder Dewhurst continues their regular Sunday Sessions. Talking Sunday sessions, Swindon promoters Songs of Praise do similar at The Tuppenny, find the Richard Wileman & the Amy Fry Experience there this Sunday 8th.

Week 2

Second week of March then, then we’re done and you go vacuum the hallway, or whatever else is outstanding; never ends, does it? Extinction Rebellion Devizes and Marlborough holds workshop “Roots of a Regenerative Culture,” Monday 7pm at The Barge on Honey Street. This training demystifies how to make everything we do regenerative and, as such, it is the key to understanding how to build resilience within ourselves and our communities.

er

Tuesday 10th there be a Quiz Night at The Vaults, Devizes in aid of Opendoors. And the Devizes Film Club has a Mexican movie, The Chambermaid (15) at the Town Hall. Director Lila Avilés’ first film quietly pulses with life in a multi-storey luxury hotel in Mexico. We see the engrossing work of a young, single mother trying her best to be promoted by thorough work, and to study in what spare time she is allowed. There is no life-saving Hollywood romance, just the drudgery of her daily work, problems with her fellow workers and managers and her efforts to improve her life. Cartol acts with sublime understanding of her role. With persistence and wry humour, she rearranges her tasks for variety, wickedly teases the window-cleaners, goes to evening classes and reads Jonathan Livingston Seagull. A subtle gem of a film, beautifully shot against the boring and colourless back-rooms, lush guest-rooms and the stunning city views.

Wednesday 11th at Marlborough’s Merchants House Michael Hart presents “Protestantism and the English Character.” While one of the most intriguing and exciting collaborations on today’s folk scene, Peter Knight, legendary violinist and ex-Bellowhead member John Spiers brings an evening of improvisation and invention of mysterious tunes to Pound Arts in Corsham. In Devizes, it’s time again for the acoustic jam at the trusty Southgate.

blossoms
Blossoms

Blossoms play the Bath Forum on Thursday 12th, revealing their new album, Foolish Loving Spaces. They explain, “The album is a pure celebration of love in all of its splendid and baffling guises, toying with the so-called sins of lust and forbidden infatuation. It’s inspired by a summer spent listening to ‘Stop Making Sense’, ‘The Joshua Tree’ & ‘Screamadelica’.” If you’re in Swindon though, head for The Tuppenny, where the awesome Jake Martin and Jess Silk perform acoustic. Acoustic, made for Thursday, eh? If you disagree, check out the Winchester Gate, Salisbury where top Ramones tribute, The Ramonas are guaranteed to liven it up.

losttrades3
The Lost Trades

Friday is the night when the county finally gets ready for the debut gig of super-group The Lost Trades. Highly anticipated amalgamation of our good friends, Phil Cooper, Jamie R Hawkins and Tamsin Quin. We wish you the very best of luck, guys. They’ll be supported by Timid Deer and Vince Bell at Trowbridge’s Village Pump.

KnKY-logo-No-Reading-2018-1024x184

Meanwhile, keeping Kalm ‘n’ Kind in Devizes, there’s a Restorative Yoga class with Kim Pierpoint, a Fundraising Quiz Evening for Opendoors at 7.30. Philippa and Declan Morgan are running the quiz at Wiltshire Museum. Tickets £10, including nibbles and a glass of wine. Reserve your ticket online and pay on the door! https://devizesopendoors.yapsody.com/event/index/533176/quiz-evening

On my never-ending list to do is get to “Pelly,” kudos for putting on live music gigs, guys, just got work early in the mornings! Drew Bryant is live at The Pelican Inn on Friday, Lewis Clark & The Essentials with folk, soul, and blues at The Southgate, and there’s a Queen tribute called The Bohemians at the Corn Exchange. Comedy Night at Bradford’s Boat House with Jake Lambert, and the amazing Frank Turner plays Bath Forum.

lewisclark
Lewis Clark & The Essentials

Tuesday is St Patrick’s Day, but Devizes’ Cavalier can’t wait, and present a St Patrick’s theme weekend with those brilliant Day Breakers in the Community Hall on Saturday 14th. On the other side, three-piece rock originals, the Lightnin’ Hobos play The Southgate, and if you’re not spoiled for choice this Saturday, I don’t know when you will be, as the one and only Pete Gage plays with Innes Sibun and Jon Amor, all backed by Ruzz Guitar Revue at the Sports Club, corrrrr, that’ll be awesome.

revmarch14

Extinction Rebellion Devizes and Marlborough are back at the The Barge, Honeystreet for a gathering, where the evening presents a stripped back, 3-piece version of Troyka Bristol, Troyka Mala. They play a stormy mixture of traditional and original songs and rhythms from the former Yugoslavia and the Balkans with brushes of Klezmer and the Middle East; intrigued? I am.

Powerhouse Gospel Choir play Melksham Assembly Hall while Jon Hopkins is at Bath Forum. For something more off planet, stoner rock and electro art-punk are promised at the Three Horseshoes, Bradford on Avon, with Head Noise, Conspiracy of Chaplains and The Forgetting Curve.

TLT artwork

That’s about all, we will follow this up with the final fortnight of March, when I get around to it. I do, though wish I’d stop promising these things! One thing you can depend on, Saturday in Swindon will rock with Splat The Rat at The Merlin on Drove Road, unfortunately, I cannot recommend Talk In Code’s new single Talk Like That enough, see our review. Note, the launch party is at the Castle on this particular Saturday, the 14th, and I can’t think of a better way to finish this lengthy roundup off!


© 2017-2020 Devizine (Darren Worrow)
Please seek permission from the Devizine site and any individual author, artist or photographer before using any content on this website. Unauthorised usage of any images or text is forbidden.

Adverts & Stuff!

winterales2020rnbregmarlmelkfosroughpheasentdevvefin2final rowde ve day posternewadvertadborn to rumtraintroylachy

Truth Sluth: Epistemological Investigations for the Modern Age

One of the most intriguing blurbs to a local event to catch my eye on recent online travels, in this humble but perpetual quest to bring you news of happenings, has to be a new performance from a Bristol/South-West theatre group, aptly named the Modest Genius Theatre Company. “Truth Sluth: Epistemological Investigations for the Modern Age,” is touring locally, and coming to Trowbridge Library on Tuesday 7th April, Warminster’s on the morning of Wednesday 8th April, the afternoon at Devizes Library on the 8th and Calne on Thursday 9th.

truthdevizes

Targeted at everyone aged seven and up, Truth Sluth is a choose-your-own-adventure comedy show that will make laugh, think critically and question everything. It explores contemporary issues surrounding fact and fiction, and asks “ever wondered who you can trust? Ever read a blog and doubted its veracity? (Hummm; ed!) Is your newsfeed feeding you fake fodder? Truth Sleuth is on the case of fake news.”

Pre- booked tickets are £5 and are available from www.modestgenius.co.uk or telephone 01249 701628. Tickets on the door are £7 (cash only for on the door tickets.) Then, be ready to “join Truth Sleuth to gather clues, make decisions and steer the action. Come on down to the birthplace of information itself, the oracle with a public toilet: your local library.”

The Modest Genius Theatre company are fast becoming renowned for their innovative, dark physical comedy about social taboos. Based in Bristol and the South West, the company was formed in 2015 by graduates of the Lecoq, Gaulier and Dell’arte theatre schools, Tristan Green, Sidney Robb and Tess Cartwright. Using clown, mime, physical theatre, storytelling, movement and music they mesmerise audiences with poignant material that takes you on an emotional journey. “We love the extremes,” they tell, “and give our audience permission to feel how they feel.”

truthmain

Truth Sluth: Epistemological Investigations for the Modern Age is hot topical comedy, in collaboration with Canadian playwright Greg Cochrane, and Pound Arts. Using physical comedy, storytelling and clever wordplay, this is devised theatre that obliterates the fourth wall. I don’t know about you lovely lot; I’m delighted to hear local libraries hosting something so intriguing and hope it’s the beginning of more such performances.


© 2017-2020 Devizine (Darren Worrow)
Please seek permission from the Devizine site and any individual author, artist or photographer before using any content on this website. Unauthorised usage of any images or text is forbidden.

Adverts & Stuff!

winterales2020jumbleopenregmarlrevmarch14roughpheasentmelkfosdevvefin2final rowde ve day posterborn to rumtraintroylachynewadvertad

From Devizes to Disneyland with MACs!

For want of a feel-good story this stormy weekend, what a marvellous opportunity for the kids at MACS Theatre School, as a group performed a musical melody Halloween show on the main stage at Disneyland Paris this week. “Each and every one of them were absolutely fantastic, and a pleasure to take on the trip,” the Devizes theatre school announced.

macs5

A proud moment for the school, and a memory that’ll last a lifetime for the group. Twelve-year old Evie, who performed, said, “I had the best time with MACs last night, attending has given me the confidence I never knew I had.” Many other parents and children have expressed their delight at the chance. It’s an achievement proving what we’ve said before, “Mac’s Theatre School is refining local drama and putting Devizes on the map!”

macs4

With a high quality of standards, Mac’s aim is to “create and produce theatre that excites, entertains but more importantly inspires. Giving young people a chance to shine, to challenge themselves and exceed expectations,” and I think this news goes to show just that, if you’ll pardon the pun!

macs3

“We’re so incredibly proud of them,” said Emily Dodd, assistant director and Mini Mac coordinator, “the show was a huge success!” Held in anticipation since the wonderful “Our House” performance, I asked if she could give us a hint as to what might be next for MACs, or if it’s top secret?!

macs6

“We’re taking a break from big shows this year so we can spend time with our own little mini Mac! However, we will continue with our full membership groups, which run on a Wednesday and our mini Mac’s sessions on a Monday.” Membership fee is just £15 for weekly workshops. Weekly workshops run as Mini Macs (aged 5-10), First Stages Group (aged 11-13) or the Centre Stage group (aged 14-16.) Places are available, contact: macs_theatre@yahoo.com for more information.

macs7

As for me, I’d risk a roller-coaster ride, but I’m not singing and dancing; no one needs to see that, even Mickey Mouse! I’m just wishing all those involved my very best wishes for the future. Well done to all!


© 2017-2019 Devizine (Darren Worrow)
Please seek permission from the Devizine site and any individual author, artist or photographer before using any content on this website. Unauthorised usage of any images or text is forbidden.


Adverts & That!

KnKY-logo-No-Reading-2018-1024x184Carmen A5 Flyer.indd

coatefirew
Fireworks at the New Inn, Coate has been postponed to Sunday!

krazee1lanternrowdechristmasposter19pelican2female2019regpewsoundaffpelicanrevmarch14newadvertad

Forty Years of The Wharf Theatre, we look forward as well as backwards.


imagesQK622M0N

Now a trail of leisurely pursuits, remnants of an industrial thoroughfare are still visible on The Kennet and Avon Canal. While some lay dormant and dilapidated since its decline in the 1850s, many have been put to good use. Enhancing the tourist attraction, cafes and inns make use of warehouses and wharfs, but none perhaps as much as the small, 18th century warehouse, adjacent to the Kennet & Avon Canal Museum at the Devizes Wharf.

It’s been home for The Wharf Theatre for the past forty years, officially opening on the 16th May 1980 with a production of J B Priestley’s When We Are Married. Prior to purpose-built arts centres, Devizes was the only local town with its own theatre, and it remains the only dedicated theatre in East Wiltshire.

images87Q1HQ8U

Formed in 1947, The Devizes and District Amateur Dramatic Society, were never happy using the Palace Cinema or Corn Exchange, and though it gave them the name Wharf Theatre in ‘73, even the first premises in Couch Lane was unsuitable. It’d take another six years before Kennet District Council redeveloped the Wharf, and the site as we know it today was reserved.

Handy, perhaps that the then treasurer, John Hurley, was former assistant chief executive at Kennet District Council, but the fact we have our own theatre is largely due to him and wife Beryl. However, if you think the theatre is all a bit hoity-toity for you, consider it was renovated with labour provided by youth, under a Job Creation Scheme, and part-funded by the Manpower Services Commission, a quango addressing unemployment. It’s said all members chipped in to help, working alongside offenders on community service!

legallyblonde1

If you’re still not convinced, thinking this is all before my time, (me too, honest!) stick around as Devizine wishes the Wharf a happy 40th birthday, and with their autumn-winter season brochure out, highlight what’s happening over the coming season. With an incorrigible womaniser, ghostly horror, an amateur boxer and a pimp, skiffle and comedy songs, flap-tastic family comedy and pantomime, oh, and Boycie, there may be something for you.

wharflshop2

It starts 23rd -28th September with a ghost story, and everyone loves a ghost story. The Turn of the Screw, which we previewed here.

turnscrewwhatrf

On Friday 4th October they trace back a plethora of comedy songs. Probably The best Comedy Songs in the World Ever…. Maybe! covers a history of comedy songs, from Noel Coward and Lonnie Donegan to Monty Python and The Goons. Bernie Cribbins is in there, and of course, if they need any props for the customary Benny Hill song, I’ve a milk bottle or twenty.

ProbablyTheBestComedySongs

Also note I can do a cracking impression of both Boycie and Marlene, but not to order. John Challis has an audience with on 12th October, revealing on-set secrets from Only Fools and Horses and the actors Sir David Jason and Nicholas Lyndhurst. You know this one makes sense, Rodders.

OnlyFools_Boycie

Comedy a running theme for the early autumn, Alan Ayckbourn’s Living Together runs from 21st to 26th October, introducing us to the incorrigible womaniser, Norman, and his family of recognisable middle-class types whose personalities are never quite as predictable as they seem.

DuncanNovelle_MaggieRegan - Copy

One of the UK’s beloved comedians and impressionists, Duncan Norvelle and award-winning singer and entertainer, Maggie Regan visit the Wharf Theatre on November 1st. Combing eccentric humour with high energy roots music, it’s all funny songs, crazy costumes and virtuoso music with The London Philharmonic Skiffle Orchestra on Friday 8th November.

SkiffleOrchestra

In residence at Pound Arts, Corsham, but taking their show internationally, expect flap-tastic family comedy, when The Last Baguette Theatre Company presents The Bird Show on the 9th. Suitable for the “whole brood,” including fledglings from three plus, this madcap and touching show about birds facing changes to their habitat uses live music, puppetry and lots of silly bird jokes.

TheBirdShow

Now, I don’t wanna think about it just yet, sure you don’t either, not while the sun is still shining, but the big C wouldn’t be the big C without pantomime, and the Wharf has Cinderella running from Friday 6th to Saturday 14th December.

Cinderella

New decade, 2020 then, and nobel laureate Harold Pinter’s Tony Award-winning 1964 two-act play, The Homecoming runs from Monday 27th January to Saturday 1st February. Directed by Lewis Cowen, this is vintage Pinter, but its twists are worthy of Alfred Hitchcock.

TheHomecoming

When Teddy, an expatriate American philosophy professor, brings his wife Ruth to visit his old home in London, he finds his eccentric family still living in the house; his father, a retired butcher, his uncle, a chauffeur and his brothers, an amateur boxer and a pimp. In the conflict that follows, it is Ruth who becomes the focus of the family’s struggle for supremacy.

With a rich history, notable past performances and maintening an eminent yet pragmatic, hospitable atmosphere, The Wharf Theatre is something for Devizes to be proud of. Check the website for more details of performances and tickets.

untitled


© 2017-2019 Devizine (Darren Worrow)
Please seek permission from the Devizine site and any individual author, artist or photographer before using any content on this website. Unauthorised usage of any images or text is forbidden.


Adverts & All That Malarkey!

KnKY-logo-No-Reading-2018-1024x184famesigriffposter10pmixuppostpelican2newadvertadvinylrealm65217389_1310844582401986_2449299795982942208_ofemale2019

Q: What’s in the Yurt, DOCA? A: Los Galindos’ Udel

Images used with kind permission of Gail Foster

 

For me it’s not enough to say something is “weird.” To start, is it a “good” weird or a “bad” weird? If the opposite of weird is normal, and normal considered boring, then weird must surely entertain. It’s subjective; depends where you sit on the border of what constitutes an acceptable limit of weirdness. When it goes beyond this level maybe it fails to entertain you, by being so weird you cannot process any logic or reason within it, ergo “bad” weird, in your opinion.

Yet illogical or plain nonsensical has always been a backbone of humour. Many strive to extend said border, for if Spike Milligan or Monty Python pushed the limits in surrealism, Miguel de Cervantes did too, 350 years beforehand. I’d suggest there’s something very Don Quixote about Los Galindos’ Udel.

los2

Humour at its most basic level is visual, a baby will find perpetual peek-a-boo hilarious. Similarly, visual humour relies on those classic formulas; falling over, sudden disappearance and reappearance and dumbfounded surprise. Akin to silent movies, voices are minimal and slapstick in Los Galindos is bountiful, and executed with distinction. But it is weird.

See, I like weird, strive for weirdness, savour weird things, chat to sane people hopefully making me appear weirder. Perhaps I set the barrier of what constitutes too weird high. If you agree, you will love this show. If you’ve wandered past the Green and seen a Mongolian yurt and thought, well how is a circus act supposed to be staged in there, without spoilers I’ll enlighten; that’s part of the joke.

If you’re thinking where does this article stop being a thought on the word weird, and become a review for this fantastically curious show, then you’re already putting barriers at your chosen level. For I don’t want to ruin the surprise, for the show continues through to Monday, but it left me wondering at what point the show actually started. Could be as soon as everyone was seated, even when we were kindly ushered in, perhaps just outside the door. Maybe all walking past, contemplating said notion, well how is a circus act supposed to be staged in there, have already become the audience of sorts.

los3

It’s a prime example of what I’m getting at, the act is the production, the production is an act, the props are parts of the stage and yurt, and the yurt, stage, and possibly the audience too are the props. The costumes and overall impression are modest, yet charming. The acrobatics are deliberately played down like Tommy Cooper’s magic, but are exceptionally skilful.

Wrapped in essence of a humbled, poor circus family, who overdramatically welcome you, their efforts to make you comfortable and enjoy their show is the clowning element, perhaps it’s only narrative. The hazard of these disguised clowns executing daredevil circus stunts within inches of your face is worrying, and part of its attraction which will leave you in awe.

If you’re the sort expecting a traditional request, “I need a volunteer from the audience,” disregard your expectations. This is a unique and original take on circus noir, it’s clowning and acrobatics combined in a manner leaving you spellbound and pondering what exactly just happened, and why.

los4

There was a point in the act, without giving the game away, where the doors blew open, and in viewing a glance outside there was a gentle reminder you were sitting on the Green in Devizes, and not immersed in a scene from Don Quixote staged by amateurs with a homemade theatre, in some remote mountainous village north of Barcelona.

It’s fantastically abridged circus, something radical moulded into a Mediterranean era of yore, and honestly, something you’ve not see in Devizes before, or probably ever will again, even if you consider Devizes is weird!


© 2017-2019 Devizine (Darren Worrow)
Please seek permission from the Devizine site and any individual author, artist or photographer before using any content on this website. Unauthorised usage of any images or text is forbidden.


 

Adverts & All That!

devizintstreetudelbronteman1000argyflyingmonkKnKY-logo-No-Reading-2018-1024x184tamsinscandalbigjamsigriffposterpelican1pelican210pmixuppostbigyellowswinnewadvertadvinylrealmfemale2019fame

The Turn of the Screw at The Wharf

The forthcoming new season of productions at our Wharf Theatre, Devizes, kicks off with a haunting Henry James adaption they claim is not for the nervy.  The Turn of the Screw, a 1898 horror novella by Henry James, first published as a serial in Collier’s Weekly magazine, has been adapted for stage by Ken Whitmore and is directed by Lewis Cowen.

 

Running from Monday 23rd September to Saturday 28th at 7.30pm, The Turn of the Screw is set in a sprawling manor house in Bly, in the first half of the 19th Century. Henry James’ classic is one of the most famous ghost stories in the English language, and is a foundation for academics pledged to New Criticism. With contradictory understandings, critics attempt to regulate the precise nature of the evil implied. Others claim its brilliance grades its skill in creating an intimate sense of misperception and insecurity.

The-Turn-of-the-Screw-Collier's-4
By Collier’s Weekly, illustration by Eric Pape – Beinecke Rare Book & Manuscript Library, Yale University, Public Domain

Miss Grey is hired as governess to two orphaned siblings, Miles, 10 and 8 year old Flora. However, she soon discovers a dark secret and becomes embroiled in a supernatural struggle with the ghosts of the former valet and governess. She is forced to fight for the children despite fearing for her life and questioning her sanity.

Tickets (£12/under 16s £10) can be purchased from Ticketsource at: https://www.ticketsource.co.uk/the-wharf-theatre/events or at the Devizes Community Hub and Library on Sheep Street, Monday to Friday, 9am-5pm or by ringing 03336 663 366. To find out what else is on at the Wharf pick up a new Autumn/Winter brochure which is available from the Community Hub and Library and many other outlets around Devizes.


© 2017-2019 Devizine (Darren Worrow)
Please seek permission from the Devizine site and any individual author, artist or photographer before using any content on this website. Unauthorised usage of any images or text is forbidden.


Adverts & All That!

sigriffpostergardenpartyargyfameswbdflyingmonkdevizintstreetudelman1000bronte10pmixuppostfemale2019newadvertad