Phil Cooper Falls at Your Feet

I’m adiaphorous to Crowded House, I confess, probably due to timing. Late eighties, early nineties and like many-a-teenager I was gurning in a field, revelling developments in music technology. If I couldn’t dance like a puppet on fast forward to it, well, you know, some good things pass you by. This is not meandering off subject, it’s a point I’ll return to, after a heartfelt apology to the man who, this week, has produced a fantastic cover of their song “Falling at Your Feet,” and is long overdue some updated attention here on Devizine, Mr Phil Cooper.

phil2

So, it was a compare and contrast job, flicking to YouTube to hear the original, and back to confirm this Trowbridge singer/songwriter’s version, not overlooking the added harmonies of Jamie R Hawkins, is equally sublime. The only difference being Phil’s stamp, which is never a bad thing. There are occasions, such as Eric Clapton’s I Shot the Sheriff, which opens someone’s eyes to the original artist, so maybe this, alongside People Like Us who regularly cover Weather with You and make me smile, will shake me up to the songs of Crowded House. Prior, if handed them on the three-in-ten finale of Ken Bruce’s Pop Master, I’d get Weather with You, and then epically fail. Always wanted a pop master t-shirt over a DAB radio anyway (fib.)

Feeling it hugs the original pretty tightly, with a passion in Phil’s vocals which nods to the respect he obviously holds for Crowded House, there’s not much more I can say on the single, other than encouraging you to take a listen. Oh, and I hope it’s not Phil’s Red, Red Wine moment. You know, after that hit, UB40 transformed into a cover band (one reason I cringe with irony when tribute bands take on a name of one of their numerous cover versions.) Because, well, Phil’s song writing ability is first rate and, with or without the trio of aspiring local musicians; Jamie and Tamsin Quin, his input would be greatly missed.

phil3

Leading me neatly onto why I started with an apology to Phil, as fallen to the bottom of my dusty in-tray was the promise to write something about a previous project. Double-whammy then, this one dates back to summer, when I thought Phil had a new album called Nine. Whisking him a message it became clear via the reply, Nine was an older project. “I’ve decided to release it on streaming sites for the first time to celebrate it’s ninth year, nine month and nine day anniversary,” he explained.

The Nine Album was originally recorded on 9th September 2009 (09/09/09.) He wrote nine songs between the 1st and 9th and started recording the album at 9am on 9th. The album was completed that day and released at 9pm that same day, which I think clarifies the title adequately! But it coincided with a complete reworking of the album by his indietronica alter-ego, B.C.C, titled “Nein.”

n6

Maybe, I figured, its title’s conversion to German nods to the pioneers of electronic music, Kraftwerk and Tangerine Dream, as BCC is Phil’s ambient electronica side-project. Now this intrigued me, note my promise to return to my point of the rave days of yore. My love of dance music obviously holds dear to its roots in electronica, often retelling the occasion of first hearing Afrika Bambaataa’s Planet Rock in 1982 as the epiphany of said era. Yet through all the technological changes from the punks turning new romantic, to the birth of hip hop, the development of house, techno and drum n bass via the rave scene, and the thousands of offshoots since, Phil’s BCC stays close to the simplicities of early electronica, rather than do a Damon Albam and push new boundaries with Gorrillaz. So, it’s nice, yeah, it’s breezy and experimental for Phil, and if you like his music, it’s essential to check this out, but still, I dunno, may be it’s an age thing, because if you asked me which one of Nine and Nein I favoured, it’d be the original.

Blast, I’ve hung up my whistle, posse! Fetch my pipe and slippers.

For Nine is like what The Wild, the Innocent & the E Street Shuffle is to Springsteen, if Thoughts and Observations, an album which I think was the first I ever gratefully reviewed on Devizine, is his Born to Run. Relishing in the roots of a musician or band I love, discovering early works, and for this, Nine is fantastic, it captures Phil at his rawest, most ambitious, and if it fails to be as polished as Thoughts & Observations, that’s its charm. Tracks like Cloud Nine, Where I Belong and You are wonderfully composed, beautifully written. However, the BCC project might put an interesting, electronic spin on it, worthy of attention, some things, I feel, are best left the way they are.

phil4.jpg

But that’s the package you get with Phil, what a prolific genius who cares not about defining a distinct style, though has crafted an excellent one, rather ventures out there, to experimentation, to stripping back or developing a track. You have to hand it to the man, for this works on his marketing side too, a DIY enthusiast who’ll do radio but live stream shows, release on all online sources but still strive to produce a CD, a blogger who maintains an honest, familiarity with his fans, and as a promoter and producer for the trio he has done astounding works with Jamie and Tamsin.

So, if it’s solo Phil Cooper you’re listening to, or if Jamie or Tammy assist him, or if it’s a track of theirs he’s produced, or as BCC, or Get Schwifty – Phil and Jamie’s cover duo nom-de-plume, you know it’s been stamped with Phil’s distinctive style, and it’ll sound great. Which brings us full circle, and is darn good reason to check out this Crowded House single, because if Phil wants to do a cover, he will, and make it sound awesome. But for the full package, I advise you like his Facebook page, follow his Bandcamp page, subscribe to his YouTube, and naturally catch him live (next gig on 8th November at the Southgate, Devizes, Jan 23rd at The Tuppenny, live stream this Sunday at 6pm; the guy never stops for a cuppa and a garibaldi.


© 2017-2019 Devizine (Darren Worrow)
Please seek permission from the Devizine site and any individual author, artist or photographer before using any content on this website. Unauthorised usage of any images or text is forbidden.


Adverts & All That!

fameKnKY-logo-No-Reading-2018-1024x184soundaffpelicanknat19Carmen A5 Flyer.inddcraigkingdukeblkhistgimmiewarpeacetamsinscandaljamiethankpelican2newadvertadfemale201965217389_1310844582401986_2449299795982942208_o

Top Twenty Best Vids of the Vizes!

Wet play project, can’t be bothered to go out. I’ve complied the best-loved videos documenting our crazy lil’ town, yet it can be updated if you know of a better one? And not one of your barbeque party where cousin Billy lost it on the trampoline; I’m not Harry flipping Hill and you won’t get two-hundred and fifty quid out of me, lucky to blag 10p. Let the arguments commence, but I’ve tried to top twenty the best, based on historical fact, entertainment value, general nostalgia and quantity of eighties short-shorts.

1- I was fascinated to watch this near on half-hour 1956 silent film, A Small Town Devizes. Made by cameraman David Prosser, from a series of similar Small-Town shorts. It features the lives of people in Devizes during Carnival Week August 1956. In the YouTube notes there’s an extensive list of people and companies which featured in the film. If it brings any notable points of interest it must surely be lobbying DOCA to reintroduce the drag-your-wife-along-in-a-pram-attached-to-a-motorbike race, methinks.

2 – Lion in the Hall! Courtesy of BBC Points West, the day in 1980 when escaped circus lions paid Devizes School a visit during the lunch hour goes down in history. Were you there, are you showing your age, and did you try feed the lion your mate’s school tie? What about today’s pupils, do you think Mr Bevan should reinstate this lion, maybe give him a TA job? Would your teacher benefit from fighting a lion, it might help to maintain the pupil’s interest in the lesson?

3 – Boto-X clip 1986. See, my Devizes born and bred better half told me about this strict health & safety regulated event and, if it hadn’t been Devizes, I’d probably have branded her a liar. Delighted to see Caen Hill Locks dig up a clip of this incredibly brilliant Boto-X from 1986. Stop! Win a Colour Telly!

4 – Oh get off my back, I’ve read Tess of the d’Urbervilles, just not any other of ol’ Tom Hardy’s books, it’s not like he’s going to hassle me about it. Far From The Maddening Crowd was his first major novel, and had four film adaptations. John Schlesinger’s 1967 MGM version was part filmed in Devizes, and Bill Huntly of Devizes Television loses his shit about it like it was Casablanca or Star Wars; bless. There are some great clips of the film in this interview, of people drunkenly singing and dancing in the Market Place; something you don’t see every day, eh? Yeah, I know, right, not that far from the maddening crowd at all really, wait for the bin to kick out.

5- Out of all Simon Folkard’s gorgeous aerial shot films, last year’s snow-covered town and canal was undoubtedly the most breath-taking. Oh, that Beast from the East, looks beautiful from above, but just to think, I was wheel-spinning a milk-float down there somewhere, holding on to me gold-tops for dear life.

6- While we’re on the subject of the milkman, here’s Madness disciple Mark’s moment in the spotlight as BBC Wiltshire focus on Plank’s Dairy. It has to be nine below zero before he puts his long trousers on, no one needs to see those knees, Mark. Ask him to whistle a Thin Lizzy tune on his round, I double-dare you.

7- 19 36- Last Train From Devizes. Post-punk poets, Browfort, ingeniously fuse synth-pop and local history in this video about The Beeching Axe and the last train from Devizes in 1966. There’s some great railway footage, mixed with their performance at The Bell on the Green. There’s no evidence to suggest the band will reform as Julia’s House to pay tribute to the first train from Devizes Parkway, when…. erm, if it happens.

8 – If you’re considering shoplifting for camera film in town, watch this early-eighties adaptation of the story of Ruth Pierce by Devizes Cine Club, and you’ll quickly be bored into submission. It really is so bad it’s good. I need not mock it, the acting, production and deviation of facts does it for me. Just to say though, is it me, or does the lead role sound a little like Claire Perry?!

9- We love our whacky historian John Girvan, the only man to enter the Town Hall lock up and live to tell the tale, save for feasting food festival fanatics who failed to note there’s the far comfier Peppermill across the road. But did you know, rather than most men whose interests lie more on what’s inside them, John confesses a love for brassieres? So, if your bra goes missing from the washing line, you know who to point the finger at.

10- Proof that either the legendary ghost of Room 4, or stranger still, the Black Swan’s window cleaner has five fingers. In 2014 the Visual Paranormal Investigations team trucked their mystery machine into our town and, without the great Dane and giant sandwiches, set up an experiment to find out if the ghost broadcasts on FM, like Ken Bruce.

11- More actual evidence in this charmingly narrated clip, this time of the Muppetry of the new traffic light system on London Road. Evidence the road planning department of Wiltshire Council are, and I quote, “retarded!” Classic, don’t hold back Truthseeker. I don’t know who you are pal, but you’re defo not Philip Whitehead.

12- There’s countless musical performers I could include here, but perhaps the widest known and appreciated is blues legend Jon Amor. Here he is, at the International Street Festival 2015 with a lengthy but worthy song, Even After That.

13- Talented Arthur Plumb, the Juggling Unicyclist at Sidmouth Street Festival 2015. While there’s a vast amount of street acts posted to YouTube, from our street festivals and carnivals, if I could only pick one it’s this entertaining Devizes TV presentation of a rather youthful Arthur Plumb. Three years ago, Shambles trader Bill Huntly was fast becoming our town’s TV host, where did he go, someone nick his cravat? Seriously though, hope you are well Mr Huntly and wishing you all the best; we loved your short films.

14- Usually reserved for the still camera, Nick Padmore is a man loved by our local music scene, for capturing the essence of its performers. Here though he videos the man, Vince Bell at Sheer Music in the Fold. Not intending to post too many music-related videos here, this 2017 performance is a must, if not just for Ship of Fools, but his amusing ditty about Devizes, Nobody Gets Out of Here Alive, right at the end of this film.

15- If you ever wondered why Tesco shut its Devizes metro branch, this may go some way to explain why. Yep, never had a lick of paint applied to it since the release of Michael Jackson’s album Thriller. The staff were friendly though!

16- Set the captives free! No really, I think they’d have moved convicts before blowing Devizes prison to the ground to make way for housing in 1927, wouldn’t they? Or did they move into the houses? Might explain a few things. British Pathe have millions of videos on their website, search Devizes and you’ll find a carnival parade of the 1920s and an Army Football Cup final from 1955, to name a couple.

https://www.britishpathe.com/video/prison-walls-make-cottage-homes/query/devizes

17- There’s nothing sarcastic I can comment here, even I wanted to, which I wouldn’t, cos I’m not like that; a gorgeously edited film of Devizes at Christmas by Chris Watkins, accompanied by a song written and performed by the equally wonderful Kirsty Clinch, makes my bells go all jingly…I said my bells!

18- Well done Paige Hanchant, for the only Harry Hill style clip I’m going to allow; capturing this amusing moment on the canal, just when it was going so well too; who ordered the chubster? Awl, bless.

19- No one interrupted the march to nip into Greggs for a sausage and bean melt in 1983, not in this pleasant three-minute video of the parade at least.

20 – Moonrakers Fable. Vintage poem narrator Alan Doel puts on his best Wiltshire accent to recite Edward Slow’s 1881 telling of the Moonrakers fable, and illustrated with postcards and emblems, makes a fair job of it. Yet the tale is known only too well in Devizes, it be rioght gurt lush to ‘ear it read in ye olde Wiltshire dialect, ewe.

That’s all folks, well, I’m sure there’s many others, but these were my favs. Not to blow my own trumpet, but Devizine does have its own YouTube channel, mostly I create wobbly musical performance clips, with a cider in the other hand and standing far too close to the speaker to do the band or musician justice, but they seem like a good idea at the time. So, subscribe at your own risk. I set it up primarily to capture this meeting with local street magician Raj Bhanot in Café Nero last summer, and here he is for a bonus vid.

Perhaps, if we get another rainy day, which is doubtful, I’ll find another set of videos based in Devizes. If you know of any which should be included then do send the link. Saucy ones to my personal email though, please.


© 2017-2019 Devizine (Darren Worrow)
Please seek permission from the Devizine site and any individual author, artist or photographer before using any content on this website. Unauthorised usage of any images or text is forbidden.


Adverts & All That Malarkey!

KnKY-logo-No-Reading-2018-1024x184famesoundaffpelicanknat19Carmen A5 Flyer.inddwarpeacecraigQuiz_Oct11thmelkhalloblkhistgimmiepelican2jamiethanktamsinscandalmikefeatnewadvertadfemale201965217389_1310844582401986_2449299795982942208_orowdechristmasposter19

Living Together at The Wharf

Monday 21st – Saturday 26th October sees the next Wharf Theatre production, Living Together, by Alan Ayckbourn and directed by Mervyn Harrowven.

 

When the Norman Conquests (named after the plays leading character, assistant librarian Norman, as opposed to the Kings William and Harold!) burst onto the theatre-going public in the early 1970s, they were a revelation. Here was domestic comedy that spoke to everyone; intelligent, well-observed and extremely funny. Today they are regarded as possibly Ayckbourn’s most ingeniously constructed set of plays.

 
The second in the trilogy, which features the same characters in the same house during the same weekend, Living Together takes place in the living room. Here we are introduced to incorrigible womaniser, Norman, his wife’s family and a vet.

 
Certain liaisons have been arranged but when plans change, and Norman drowns his sorrows in a bottle, the scene is set for the testing of married relationships and the comic dissection of middle-class morality.

 
Tickets (£12/under 16s £10) can be purchased from Ticketsource at: https://www.ticketsource.co.uk/the-wharf-theatre/events or at the Devizes Community Hub and Library on Sheep Street, Monday to Friday, 9am-5pm or by ringing 03336 663 366. To find out what else is on at the Wharf pick up a new Autumn/Winter brochure which is available from the Community Hub and Library and many other outlets around Devizes. Tickets for this year’s panto, Cinderella are being snapped up, so get in quick!


Adverts & All

KnKY-logo-No-Reading-2018-1024x184fameCarmen A5 Flyer.inddsoundaffpelicanknat19craigmelkhallopelican2female2019gimmienewadvertad

Devizes Food & Drink Festival opens with the Street Food & Artisan Market

Parking in the Market Place today yes I did, parked my butt on a Muck & Dunder Chair and took in a great Devizes Food & Drink Festival Street Food & Artisan Market, thank you!

Yo-ho-ho, an unpredictable drizzle didnâ stop th’ Devizes Food & Drink Festival settin’ thar grand Street Food & Artisan Market sail today, launchin’ into a chockful week o’ various foody events. ‘Twas me first attendance last year, and not for want, I’ve nah other grub festival t’ compare it to. Nevertheless, thought ’twas great, ‘n I’d been lookin’ fore t’ saunterin’ th’ Market Place once more, landlubber, testin’ ‘n tastin’ th’ wide variety o’ grub ‘n drinks, even tried t’ starve meself beforehand!

fooddrink

This isn’t the Sun tabloid, usually don’t fib here, I did say “try;” truth be told, I loaded up on a cooked breakfast earlier; still, I’m a bottomless pit. They say that though, don’t they? Don’t go to a supermarket on an empty stomach or you’ll end up overspending, guess the same applies to a food fest. That’s the excuse I’m sticking with. With all homemade or small business enterprises, the stalls here aren’t Lidl-cheap, but you know your taste buds are in for a treat. The reason for the pirate-translated opening paragraph? Between all these great stands, our beloved Muck & Dunder Rum Bar stole my show……cos, they like, sell rum, see?!

20190706_172017

Perhaps to their advantage, they were located by a seating area and the music marquee, this year supplied by Wadworth. All it takes is a little reggae during the band’s breaks to entice me, and many others, over. They really know their rum, better than Uncle Albert, and if this review is slightly jiggered, blame them! Not entirely though, I also sampled Majorcan gin, from Gin Eva, which I liked despite gin not being mi ting, mon. Back to suspiciously loiter the square where Shelly from the abovementioned Muck & Dunder swung around with a trayful of pina colada, and Frome’s eclectic-influenced folk four-piece, The Decades entertained the masticating crowd.

IMG_2800

I butted in to introduce myself, as although this was the only band booked, they were more than apt. With a pleasant folk angle and generous banter their style was offbeat, comical and proficient. Covers such as Pulp’s Common People and the finale of The Fun Boy Three’s Lunatics Have Taken over the Asylum particularly adroit and amusing. Vaunted our humble Southgate in hope they’ll pass our way again, and much to my delight Deborah and Dave magically appeared like Mr Ben’s shopkeeper and exchanged contacts.

Spoiled for choice when it came to a street food lunch; The Notorious Pig, Cantina El Burrito, Japanese food with a Filipino fusion from De la cuisine, Bath’s varied White Heat, Dorset’s Fanny Annie grilled cheese butties, Salisbury’s The Tasty Tapas, vegan Firmly Planted, Greek-inspired Cosy Kitchen, and the Gourmet Goat Farmer with everything goat, even soap, which I guess is to wash your goat, or goatie beard, or even, possibly, soap made from goat’s milk; didn’t like to investigate further. No, I went to Take a Bao, it was new to me, and lush, like Asiany stuffed dumpling balls.

IMG_2796
For washing your goat

Here’s the thing though, the portions are served quite large, I mean, I like large, don’t get me wrong, but with so much to choose from, a little half-size, half-priced dish would enable a little more experimentation from the punters, rather than having to select one for lunch. Opposite is the scale of the event, due to the powers of perspective a passer-by may wrongly perceive the event as quite petite, but once among it, there’s a copious amount to take in. And that copious was excellent, a variety of splendour; can we do it again next week?

If you’re stuffed there’s stuff to take home too, and it was abundant; both Harry’s and Rutt’s Lane Cider, The Incredible Brewing Company, Plenty Pies, The Leafy Tea Company, Glastonbury Cheeses, Olives ‘n’ Stuff, Stainswick Farm Oil, those wicked chutneys from The Cherry Tree and Calne’s own Waitey’s, with their exclusive range of Chilli Jam, ah, I could go on. My arm was twisted into trying Blood Orange Liqueur from The Wiltshire Liqueur Company Ltd, and Harry’s Mango & Lime cider.

IMG_2797

I mean, cripes, I haven’t even mentioned pudding; Purbeck Ice Cream, may’ve won a slightly warmer day, the variety of vintage sweeties from The Sherbet Piglet was overwhelming, my arm near twisted by the stupendous brownies of the Welsh Ridiculously Rich by Alana, but I ended up back on the bus with a doggy bag of Malteser brownies from the wonderful Gourmet Brownie Kitchen based over at Poulshot Lodge. Word on our streets are these are the best brownies around, and even as a connoisseur of the brownie, I was not disappointed.

Award for the most novel though, goes to Butternut Box. Without a show of samples, without much of an ascetically pleasing display, this innovative company freshly prepare and deliver homemade dog food. Now, I’m not a dog owner, just thought it different, that here’s some dog food which looks edible for human consumption, and if it wasn’t for all these brilliant and wonderful food stalls, given perhaps a few more rum samples, yeah, I reckoned I’d have tucked in!

IMG_2799

A delightful opening to this year’s Food Festival then, and with a new thing, the World Food Lunch at The Corn Exchange tomorrow, (Sunday 29th September from 12.30) where admission is free, and taster portions allowing you to explore the globe on a plate, are just 50p, it just gets better.


© 2017-2019 Devizine (Darren Worrow)
Please seek permission from the Devizine site and any individual author, artist or photographer before using any content on this website. Unauthorised usage of any images or text is forbidden.


Adverts & All That Malarkey!

KnKY-logo-No-Reading-2018-1024x184famesoundaffpelicanknat19pelican2Carmen A5 Flyer.inddnewadvertadcraigtamsinscandal65217389_1310844582401986_2449299795982942208_ofemale2019

The New Society of Devizes

If you drop into the old Tourist Information centre in the Market Place these days, you’ll get much more than a leaflet on the Caen Hill Locks.

The owner, Steve, greeted the better half and I by the stairs, outgoing but with a shattered expression. The word on the street is out, in an unmissable location, cafe-lounge-bar New Society puts the old building to exceptional good use. It talked the talk, receiving rave posts on social media, and as passing by I witnessed it bustling on Saturday night, I’d be fool not to give it a lunchtime stab and see if walks the walk.

newsoc5

Anything new in Devizes attracts initial attention, the issue is maintaining interest. Staff at New Society have been working tirelessly for the past fortnight to ensure it lives up to first impressions, yet they show no sign of tetchiness when it comes to serving you. Combine this family-styled friendliness with an extensive menu, reasonable prices and this beautiful bespoke setting, New Society is everything they say it is, and more.

newsoc4

It sits somewhere between high-end restaurant and archetypal pub, matching the restaurants for quality but the latter for worth, but does so enthusiastically and cordially. It’s also extremely diverse; tapas on the menu, and coffee bubbling, there’s an element of Mediterranean in ethos, but open for a cooked breakfast, decor decidedly quaint pub, plus the bar resembles a wine bar running through to the evening, it’s fundamentally local too.

newsoc6
Vegan Breakfast

Yet you’ll see no noses in the air, or sawdust under a ragged pool table, it’s as if New Society has melded the pros of all these types of establishments and scrapped the cons.

newsoc3

I could’ve randomly stuck a pin in the menu, between said tapas, burger menu and omelette bar, it consists largely of every pub grub classic you could hope for, but refined; sandwiches and toasties, fish n chips, ribeye steaks, mac & cheese, Caesar salad, etc. Coupled with a similar desert selection, and from beers, ciders, cocktails and wine to tea, coffee and milkshakes, there’s something for all, including vegans and children. Mrs Devizine is often impatient to my lengthy menu browsing, and worried I’d spend an eon or three interrogating this varied one, I opted for a pub classic, chicken tikka masala, post-haste. She went for an omelette.

newsocours2
This was our hoard, the other photos I’ve just borrowed, didn’t eat them all, but I could’ve!

But where the menu isn’t exactly exotic, hot dang (can I say hot dang in a serious food review; who cares?) if it didn’t taste far beyond that of standard pub grub. The tucker was presented nicely, to match the surroundings, and tasted equally as mouth-watering. Ingredients of excellent quality, my curry served with pilau rice was simply gorgeous, fresh pulled chicken, spiced beautifully and with a naan toasted to perfection. Home-cooked, these guys don’t know what a microwave is. The wife agreed, her omelette was fluffy, and chips to die for. To take two rather standard pub grub dishes and make them something rather special makes this alone the perfect lunch location.

newsocours

Not to mention we were sat next to a brilliant stained-glass window depicting the Devizes crest; the advantages of taking over the tourist information centre, I guess, but without the need to go in there, I’d never seen it before, had to take a snap! There’s a selection of comfy sofa seated areas, and traditional tables spread over a ground floor and two smaller rooms upstairs, all exceptionally welcoming and easy-going, just like the atmosphere. There was a sense in the air that New Society is excitingly innovative, interestingly middle-ground, and will become a standard for others to aspire to. It’s quickly become a hub in town, now I know why.

newsoc7


© 2017-2019 Devizine (Darren Worrow)
Please seek permission from the Devizine site and any individual author, artist or photographer before using any content on this website. Unauthorised usage of any images or text is forbidden.


Adverts & All That!

KnKY-logo-No-Reading-2018-1024x184sigriffposterCarmen A5 Flyer.inddfamesoundaffpelicanknat19nursequizpelican2melkhallonewadvertadcraigfemale201965217389_1310844582401986_2449299795982942208_ogimmie

REVIEW – Hadrian’s Union @ Southgate & Jamie R Hawkins @ White Bear, Devizes – Sunday 22nd September 2019

Another Great Music Sunday Afternoon

Andy Fawthrop

First to The Southgate, where Dave & Debs continue to provide a platform for acts of class entertainment. Today it was 5-piece folk-rockers Hadrian’s Union, a band completely new to me. Except that their fiddle-player Penny wasn’t actually with them, so they just carried on as a four-piece, on their Penny-less tour. Geddit? Oh, never mind.

The line-up included Saul Rose on drums, Brian Bell on 5-string bass, Robin Jowett on melodeon and keyboards, and founding member Stew Simpson on guitar and vocals. Saul Rose, who produced their last album, is as good as folk royalty, having played with a wide range of famous folk bands (Faustus, Mawkin, Eliza Carthy’s Wayward Band). Normally he plays accordion, but had decided, just for the hell of it, to get back to his first love the drum-kit.

hadrain1

They hail from the debatable northern lands of the English and Scottish borders, and had had a very early start that morning in order to make this gig. Their name originates from the locality and mindset of the band, since their separate members are based along various points of Hadrian’s Wall. They come to the band from various music genres – folk, punk, rock, blues, Celtic, ska etc – which reflects in the music they create together. They quote their musical references as Lindisfarne, Jethro Tull, Stackridge, and The Bonzo Dog Dooh Dah Band.

I quickly discovered that this meant an eclectic and varied set of self-penned songs, but paying musical dues to all those traditions. One minute we were in full rock mode, the next minute we were in a folk club, listening to traditional morris tunes. If they are rockers, they were very folky, and if they were folkies, they had a mean line in driving blues/ rock. Great stuff, and the packed crowd really lapped it up, whooping and dancing to just about every number. The sound was relaxed, yet tight, and every number was delivered with confidence and impeccable timing.

Upcoming gigs at The Southgate are:

• Friday 27th Sept Pink Tribute (Beautiful Trauma)
• Saturday 28th September Phase Rotate & Cobalt Fire
• Friday 4th October James Hollingsworth
• Saturday 5th Oct ober Jon Walsh

hadrain3jamie

Then back into town to the White Bear, for the latest of Marc & Georgie’s Sunday Sessions, this week featuring local favourite and all-round good egg Jamie R Hawkins. It’s a sign of the level of esteem in which Jamie is held that this was probably the best crowd these Sunday Sessions have attracted so far. This time not surrounded by & supported by his musical friends, but playing the whole of his two sets on his own, Jamie delivered (as ever) a superb performance of self-penned and very personal songs. Those of us who have been following him for a while are obviously familiar with much of his material, but we never tire of hearing those songs again, especially when each performance (like this one) is delivered with such intensity and feeling. And of course, we liked the way he works in the new songs. The atmosphere was great, the crowd loved it, and we had a great afternoon all round.

Next week’s Sunday Session (29th Sept) @ The White Bear @ 5pm features Fraser Tilley.


© 2017-2019 Devizine (Andy Fawthrop)
Please seek permission from the Devizine site and any individual author, artist or photographer before using any content on this website. Unauthorised usage of any images or text is forbidden.


Adverts & All That!

sigriffposternursequizknat19fameCarmen A5 Flyer.inddsoundaffpelicanpelican2KnKY-logo-No-Reading-2018-1024x184jamiethankmelkhallocraignewadvertadgimmiefemale201965217389_1310844582401986_2449299795982942208_o

The Malone-Sibun Band and Joe Hicks at the Long Street Blues Club

A cracking night for our blues club last night, which I managed to finally appear at!

After publishing a run of awesome reviews from our man Andy, and with a flimsy hunch he wasn’t going to make it Saturday night (though he did,) I figured it high time and a good opportunity to break my Long Street Blues Club cherry; can’t let him have all the fun.

If I only popped my head around the door towards the end on a previous occasion, it was plentiful to note in our preview of their new season that, “there’s a lack of background noise at Long Street, the audience don’t chitter-chatter through the act like the backroom of a pub, it’s a fully entrancing appreciation society.” In fact, upon entry I was thanking Ian Hopkins the organiser, only to be shushed by a member. Who shushes at a gig? At least one in a hall chockful of blues aficionados captivated by the music, that’s who!

After pondering out loud, feasibly too loudly for this attendee, if this blues club needs a review at all, being it’s marked with exceptionally high-regard on our music scene and the hall of the Cons Club is bustling, I took heed of Ian’s reply, “any publicity is good publicity,” and tiptoed to the bar as if in a Christian Science Reading Room.

With family ties to Devizes, we’ve mentioned the support act on Devizine in the past, and it was good to finally meet him, even better to hear him perform live. Newbury-based answer to David Gray, Joe Hicks is wonderful, simple as. At ease with his surroundings he chats enough only to tune and give a modest synopsis of the following song, or to praise Livewired, for his last gig at the Electric Bear in Bath. He delivers his original songs with appetite but no strain, and aptitude which he makes look like child’s play. Among others, we were treated to his new single, Swim and another spellbinding comfort song called Rest Your Head. Mildly dreamy rather than sombre, his chants sublime, making a perfect cover of Fleetwood Mac’s Everywhere so apt for a finale.

long1

Now for the main act, you know how levels of cool range? I mean, there’s that mate in the pub with the amusing party-trick, he’s pretty cool, right, but compared to someone like Hendrix, he’s a total nerd. Smoothly Detroit’s Marcus Malone frontstages, oozing cool from his gaze to his fingertips like the lovechild of aforementioned Hendrix and Lenny Kravitz. His talent replicates his persona, and combined with a tight band, and Devizes-own electric blues guitar-legend, Innes Sibun, this is loud, proud and quite simply, mesmerising.

I realise now, witnessing the brilliant Beaux Gris & The Apocalypse, and Mr Amor, I was only a fraction engulfed into my epiphany of contemporary blues, the Malone Sibun Band completes it. Innes may appear more like that air-guitar playing headbanger at school who was asking for bullies to pick on him, drawing metal band logos on his army surplus bag in biro and all, but this guy wows and visually loves that he’s wowing, probably sighting a said school tormenter in the crowd, rocking out! The quality of this duo, this collective, is second-to-none, and their music takes no prisoners.

long2

It was rock, harking back to times of yore, when the blues influence was prevalent, yet more refined than psychedelic sixties, edging more towards traditional Delta or jump-blues than even Cream and Hendrix did. In contrast it was gritty, persistent and never waived from its ethos. Whether leisurelier tempo or all-out detonation, it was not experimental, rather a tried and tested formula. It neither clichéd or borrowed from previous works, it never waited for you to compare it, it was entirely unique, and it was full on in your face. There was no sing-a-long section, popular covers, there was no idle chatter; they came, they saw, they blasted their labour and treasured every minute of it.

long4

I was left entranced, my jaw hanging low and my mind whisked away, as said noise restrictions of the club crumbled, and its preconceived barriers collapsed, there was no associating the Long Street Blues Club to a library any longer. In all, this club may attract an older majority, but if you’re thinking fuddy-duddies you’d better think again! Next up, Jon Amor, his full band, on the 12th October, but you’d have known that if your read our preview! Yep, in it I did speculate The Long Street Blues is “simply addictive. Hook line and sinker,” I feared, “they’d have me in the palm of their hands.” It’s confirmed now.


© 2017-2019 Devizine (Darren Worrow)
Please seek permission from the Devizine site and any individual author, artist or photographer before using any content on this website. Unauthorised usage of any im ages or text is forbidden.


Adverts & All That!

sigriffposterfameknat19soundaffpelicanpelican2Carmen A5 Flyer.inddgimmieKnKY-logo-No-Reading-2018-1024x184psajamiethanktamsinscandalmikefeatmelkhallonewadvertadfemale201965217389_1310844582401986_2449299795982942208_o

REVIEW – Comedy Night @ Corn Exchange, Devizes – Friday 20th September 2019

A Funny Old Night

Andy Fawthrop

A fairly packed audience gathered in the Corn Exchange on Friday night for Devizes Comedy’s presentation. Not sure it was quite sold out, but there weren’t too many empty seats in the place.

 
First up was Canadian born Tanyalee Davis, described in the publicity as “Joan Rivers meets a pile driver”. She has a form of dwarfism called diastrophic dysplasia. At only 3 foot 6 inches tall, this presents a few challenges and misconceptions in her daily life, but this also provides a rich vein of material for her stand-up routine. Her material, like her, is low to the ground, quite blue and racy in places, evoking laughs both from the inherent humour, but also from the shock value. A highly entertaining opener.

comedy1

Next up was more normal sized Irishman Keith Farnan. Here was a comic very comfortable in his own skin, and very confident with his material. He delivered an absolute master-class in how to play an audience, feeding on minor and polite heckling, and casually eliciting and provoking clues and local information to mould his script. A lot of it felt extremely-well improvised, and he took great delight in holding up a mirror to the Devizes crowd’s lack of diversity. He successfully took the piss out of being middle class, being Irish, his own name, being Jewish (he’s not, but his wife is), homophobia, Ryannair and many other topics. Not topics that were exactly bleeding edge, but he wrung some absolute belly-laughs out of such thin gruel. For my money – the best comic of the night.

comedy2

After the interval, another two acts. First of these was Tom Lucy – young, slightly camp and with a mother he described as a MILF. He tried the same trick as Keith Farnan, trying to use the audience to provide clues and prompts to direct his material, but far less successfully. A number of times he ended up, by his own admission, up a comedy cul-de-sac, having to cut routines short because they just weren’t going anywhere. Better material was on modern technology – smartphones, emojis, dating apps and dick-pics. But to my mind he never really got going, and the big laughs just weren’t there.

comedy3

And finally, top of the bill, was Mike Osman. We were all asked to stand, face to the rear of the room, and put hand on heart, to allow the entrance of this Donald Trump impersonator to the strains of Hail To The Chief. A showy entrance, but to my mind, one that felt a bit flat. Once up on the stage we had the White House lectern (later revealed to contain a Kim Jong-Un lookalike) and a pair of US flags. The whole act was an extended riff on “DT comes to Devizes”, occasionally side-stepping into a (very poor) musical number, and a range of old & new impressions (I don’t think Rory Bremner or Jon Culshaw have anything to worry about). Osman had DT’s looks, mannerisms and voice, and did a fairly good impression of The Orange One, but (to me at least) failed to convince. Most of the audience found him hilarious most of the time, but the material was frankly tedious and thin, and the jokes fairly old/ poor/ standard. If this is what you have to do to earn a living…..

comedy4


© 2017-2019 Devizine (Andy Fawthrop)
Please seek permission from the Devizine site and any individual author, artist or photographer before using any content on this website. Unauthorised usage of any images or text is forbidden.


Adverts & All That Malarkey!

KnKY-logo-No-Reading-2018-1024x184sigriffposterknat19fameCarmen A5 Flyer.inddsoundaffpelicanpelican2gimmiekickers2melkhallopsajamiethanktamsinscandalnewadvertad65217389_1310844582401986_2449299795982942208_ofemale2019

Thank You, Jamie R Hawkins

If all products are carefully marketed towards a specific target audience, none I feel, are as precise as boxes of chocolates. The whole idea of taking an everyday item, the sort you might shout to your driver as he approaches the garage, “and get us a Twix,” when stuck in a box suddenly becomes a rare treat, gifted by an acquaintance for a special occasion. It’s vital you pick the correct box to suit the message; while a Dairy Box says “happy birthday, Gran,” Milk Tray says “get your kit off love!”

Connotations all in the packaging and advertising, push comes to shove, they’re the same bloody thing, but last thing you want is to hand your gran some Milk Tray. Often, it’s fallacious, a Flake is the most unsuitable chocolate bar to eat in the tub, no matter what the telly might tell you. That’s why you have to hand it to the Cadbury’s Roses ad campaign, for while it’s not the best box of chocolates, it is somewhere in the top five. But it’s the across-the-board implications; anyone can buy a box for anyone, for any reason; it’s choco impartial. Buy Roses if you don’t want the receiver to assume you see them like your grandparent, or you want to snog their face off until sore. “It’s just to say thank you;” yeah, yeah, clever bastards.

IMG_2709

New single out from Jamie R Hawkins then, unless you’d rather me waffle about chocolate? It’s like Roses though, it’s a universal thank you, for friendship, and while it may not the best Jamie R Hawkins song, it just rocked up somewhere in the top five. Though Jamie has pre-set his bar high, and if his May single, Welcome to the Family was quirkily agreeable, Thank You, Friend harks back to the classic sentiments we love Mr Hawkins for. Diluted, this song is more general and will infectiously touch all who hear it, as concentrate it profoundly assesses what a friend is, and how they’re capable of helping, in a manner The Beatles only skimmed the surface of.

Another perfect production for Phil Cooper; Jamie is on top form. “I never fail to be amazed,” he sings, “That what defeats me leaves you totally unfazed, it’s almost like I’m lacking in, the thing that makes you so alive, and it’s so good to know you’re always on my side.” Just one of the beautifully rendered verses of this fantastic song which undoubtedly showcases Jamie’s brilliance of song-writing, and with conviction he chants his own words of a song dedicated to his brother with unequalled passion.

It made me think of a time he was supporting a gig at the Cons Club; I drove out of the carpark to see him perched on the wall. Offered him a lift, he was only heading for the British, but jumped in. A handshake would’ve sufficed, but Jamie gave us a man-hug; one of the marvellous reasons why I love writing Devizine, I’ll locally praise what needs to be praised, slag off what needs to be slagged, but it’s also clear most recipients don’t view me as “the evil press,” but as a friend. And it’d be virtually impossible, I’d wager, to deliberately make yourself an enemy of Jamie, unless you’re the jealous sort of song-writer, struggling to compose a song a quarter as good as this one.

m17

He’s here, he’s there, he’s at the White Bear this Sunday afternoon, catch him when you can, it never gets tiresome despite the fact Jamie does our circuit regularly, like a J S Lowry painting, the songs he weaves always have something different you may not have picked up on before, and his new ones, well, get better and better. This new track is available today through all the music sites. iTunes is too Thornton’s for me, spotty-thigh or whatchamacallit is too, well, Haribo; here’s the Bandcamp link, it’s this old timer’s Dairy Box!


© 2017-2019 Devizine (Darren Worrow)
Please seek permission from the Devizine site and any individual author, artist or photographer before using any content on this website. Unauthorised usage of any images or text is forbidden.


Adverts & All That!

sigriffposterfameknat19Carmen A5 Flyer.inddsoundaffpelicanbigyellowswingimmiepsamelkhallokickers2pelican2newadvertadfemale201965217389_1310844582401986_2449299795982942208_o

The Twelfth Season of Long Street Blues Club

With the dependability our gallant roving reporter, Andy will attend The Long Street Blues Club and send us a review to make me jealous, I ponder if I’ll ever make have to make it down there. Thing is, the Club which is about to launch into its incredible twelfth season at the Devizes Conservative Club this Saturday, is simply addictive. Hook line and sinker, they’d have me in the palm of their hands.

Yet there’s good reason to succumb, I did pop my head around the door once, to find a hall chockful of blues aficionados captivated by the act. This is nothing rare, there’s a lack of background noise at Long Street, the audience don’t chitter-chatter through the act like the backroom of a pub, it’s a fully entrancing appreciation society.

Enough said to state, these guys know their blues, claiming for their opening night on Saturday 21st September with the merger of two forces of nature Marcus Malone and Innes Sibun, “we’ve been inundated with requests to get them back.” Coveted by Motown records, Detroit-born Marcus worked on demos with some of the biggest names in the business, before being moved to LA by Ike Turner’s management team and signing with United Artists Records.

He opened for Bob Seger and Iggy Pop, now adding BB King at the Albert Hall to his impressive résumé. Marcus has written, produced and recorded seven albums on the Redline Music Label since relocating to the UK, the magnum opus being “A Better Man.” In all, it was hearing BB King which inspired the twelve-year-old Innes Sibun to pick a guitar. Legendary producer Mike Vernon produced his first band, Blues Explosion’s debut album. By 1993 he joined Robert Plant’s band for his “Fate of nations” tour, spurring a prolific musical career.

johicks.jpg
Joe Hicks

I’m glad to hear incredible Newbury singer-songwriter, Joe Hicks will be supporting, blending his pop, blues and folk influences which Linda Serck at BBC Introducing critiques as “absolutely smashing it!”

If I needed to bio these musicians, you’ve not been indoctrinated into the contemporary blues scene, something Mr Hopkins and his crew will be able to help you with. But the name of the second night at Long Street needs no introduction. You can source blues on an international market, as they do, but Saturday 12th October is owned by the man who put Devizes on that map, Jon Amor.

jonsouthgatefeat
Jon, image by Nick Padmore

He brings the group; Mark Barrett of the Hoax, the Doherty Brothers, who’ve been enjoying a successful run as the band I can’t get enough of, Little Geneva, and keyboard genius Johnny Henderson. The Jon Amor Band, out to promote the critically-acclaimed album Colour in the Sky, will be a homecoming gig after his national tour, and you can rest assured they’ll be on top form.

 
Like Jumping Jack Flash, the blues club steps on the gas with a duo of gigs within a week. Saturday 2nd November Larry Miller band’s bassist Derek White joins the Cinelli Brothers, a project born form of a common passion for the electric Chicago and Texas blues from the sixties. It comprises of brothers Marco and Alessandro, Music Republic Magazine nominated Marco Cinelli as Best Guitar Player of 2018.

Cinelli Brothers.jpg

The following Friday, 8th November the club presents a solo, unplugged show from Ian Siegal, who Mojo credited as “one of the most gifted singers & writers in contemporary blues,” and Long Street claim it’s “simply a must.” The date unfortunately squashes a huge blues-related clash in our bustling town, with Chippenham’s Triple JD Rock Band playing the Southgate, The London Philharmonic Skiffle Orchestra at The Wharf Theatre, and the highly-anticipated arrival of Georgie Fame as a special Devizes Arts Festival evening at The Corn Exchange. While it’s clear, Devizes has an appetite for the blues, and the choice we have of live music is astounding for a town our size, this is one overloading Friday night. I only hope the best for all these great bookings, and that we have the capacity to fill them.

But business as usual for the Long Street Blues Club, it has a truly dedicated following, and this season’s line-up of shows confirm it’s standing as a benchmark for our county’s blues scene.


© 2017-2019 Devizine (Darren Worrow)
Please seek permission from the Devizine site and any individual author, artist or photographer before using any content on this website. Unauthorised usage of any images or text is forbidden.


Adverts & All That!

KnKY-logo-No-Reading-2018-1024x184sigriffposterbigyellowswinCarmen A5 Flyer.inddknat19soundaffpelicanfamepelican2gimmienewadvertad65217389_1310844582401986_2449299795982942208_ofemale2019

An Interview with Ed Byrne

With my ribs near fully recovered from giggling injuries caused by the one Ed Byrne, it’s nice to note if you missed him at the rescheduled Devizes Arts Festival evening, he’s playing Trowbridge’s Civic Centre on the 26th September, March 13th at the Wyvern, Swindon and Bath’s Forum on March 19th.

Here’s an interview with the man himself, to tempt your taste buds…. 

Jason Barlow

A household name teetering on the brink of national treasure status, award-winning comedian Ed Byrne enjoys worldwide acclaim for his stand-up. With 25 years under his belt, Ed has parlayed his on-stage success into a variety of notable television appearances. A regular on Mock The Week and The Graham Norton Show, Ed has recently co-presented Dara & Ed’s Big Adventure and its follow-up Dara & Ed’s Road To Mandalay, and managed not to disgrace himself on Top Gear or whilst tackling one of The World’s Most Dangerous Roads. As a semi-professional hill-walker himself and fully paid-up humanist, he also brought a refreshing warmth and honesty to BBC2’s recent hit The Pilgrimage.

But the Irishman is still best-known and best appreciated for his stand-up performances. A quarter of a century at the comedic coal-face has equipped Ed with a highly evolved story-telling ability and a silky mastery of his craft. Yet his wit, charm and self-deprecatory observational humour is often underpinned by a consistently hilarious vitriol and sense of injustice at a world that seems to be spinning ever more rapidly out of control.

Having recently hit a new peak with shows such as the sublime Spoiler Alert and reflective Outside, Looking In, which explored the minefield that is modern parenting and a generational sense of entitlement, Ed’s new show If I’m Honest digs ever deeper into a father’s sense of responsibility, what it means to be a man in 2019, and whether he possesses any qualities whatsoever worth passing on to his two sons. Occasionally accused of whimsy, If I’m Honest is a show with a seriously steely core.

Gender politics, for example, is something Ed readily engages with – deploying his customary comedic zeal. ‘I’ll admit that there are things where men get a raw deal,’ he says. ‘We have higher suicide rates, and we tend not to do well in divorces, but representation in action movies is not something we have an issue with. It was Mad Max: Fury Road that kicked it all off, even though nobody complained about Ripley in Alien or Sarah Connor in Terminator 2. Of course, social media means this stuff gets broadcast far and wide in an instant, which emboldens people.

‘The problem with men’s rights activists is that it’s not about speaking up for men’s rights, it’s about hating women. If you’re a men’s rights activist, you’re not going to care about the fact that there’s an all-female Ghostbusters remake. That’s nothing to do with men’s rights or female entitlement. That’s everything to do with being, well, a whiny baby.’

Photo by Idil Sukan

As ever, Ed manages to provoke without being overly polemical, a balancing act that only someone of his huge experience can really pull off.

‘I did stuff about Trump and the Pizzagate right wing conspiracy,’ he says, ‘and a couple of the reviewers said, “Oh, I would have liked to have watched a whole show of this”. And I think, ‘well you might have, but the average person who comes to see me would not like to see that’. I like to make a point or get something off my chest, or perhaps I’m talking about something that’s been on my mind, but the majority of stuff is just to get laughs.

‘People who come to see me are not political activists necessarily, they’re regular folk. If you can make a point to them, in between talking about your struggles with aging, or discussing your hernia operation or whatever it is, you can toss in something that does give people pause as regards to how men should share the household chores.’

He continues, ‘It’s not that I feel a responsibility, I think it just feels more satisfying when you’re doing it, and it feels more satisfying when people hear it. When a joke makes a good point, I think people enjoy it. It’s the difference between having a steak and eating a chocolate bar.’

Ed, who broke through in the mid-1990s when the New Lad became a genuine cultural phenomenon, doesn’t want to submit to any unnecessary revisionism, but admits that if the times have changed, he has changed with them. He reflects a little ruefully on one of his most famous jokes. ‘There’s an attitude towards Alanis Morrisette in the opening of that routine that I’m no longer comfortable with, where I call her a moaning cow and a whiny bint… slagging off the lyrics of the song is fine, but there’s a tone in the preamble that I wouldn’t write today.’

The new show also takes his natural tendency towards self-deprecation to unexpected extremes. ‘I do genuinely annoy myself,’ Ed concedes. ‘But the thing of your children being a reflection of you, gives you an opportunity to build something out of the best of yourself only for you to then see flashes of the worst of yourself in them. It’s a wake-up call about your own behaviour.’

When I challenge him over the degree of self-loathing he displays, he disagrees. ‘Self-aggrandising humour is a lot harder to pull off than self-deprecating humour,’ he insists. ‘A lot of people get really annoyed when Ricky Gervais is self-congratulatory. I always find it very funny when he accepts awards and does so in the most big-headed way possible. I think it’s a trickier type of humour to pull off, talking yourself up in that way.

‘So no, I don’t think I’m being massively hard on myself. The fact is when you’re the bloke who is standing on the stage with the microphone, commanding an audience’s attention, you’re in a very elevated position anyway.’

Photo by Idil Sukan

That said, If I’m Honest brilliantly elucidates the frustration that arrives in middle age – and lives up to its title. ‘I’m bored looking for things, I’m bored of trying to find stuff, because I can never find it, and it is entirely my fault,’ Ed says. ‘Nobody’s hiding my stuff from me. Although my wife did actually move my passport on one occasion’.

He insists that, while the show might have mordant and occasionally morbid aspects, it’s also not without its quietly triumphant moments. ‘I thought I was being quite upbeat talking about the small victories,’ he says. ‘You know, finding positivity in being able to spot when a cramp was about to happen in your leg and dealing with it before it does. I was very happy with myself about that.’

Age, it seems, has not withered him. Especially now that he’s figured out how to head off ailments before they become a problem. ‘You see comics who are my age and older but are still retaining a level of “cool” and drawing a young crowd. I can’t deny that I’m quite envious of that. But there’s also something very satisfying about your audience growing old with you.’

Ed Byrne is touring nationwide, appearing at Trowbridge’s Civic Centre on the 26th September, March 13th at the Wyvern, Swindon and Bath’s Forum on March 19th. For more information, please visit http://edbyrne.com/


© 2017-2019 Devizine -Syndicated with permission from Jason Barlow.
Please seek permission from the Devizine site and any individual author, artist or photographer before using any content on this website. Unauthorised usage of any images or text is forbidden.


Adverts & All That!

KnKY-logo-No-Reading-2018-1024x184sigriffposterfameCarmen A5 Flyer.inddknat19soundaffpelicanbigyellowswintamsinscandalgimmiemikefeatnewadvertadpelican265217389_1310844582401986_2449299795982942208_ofemale2019vinylrealm

Blues On A Sunday: Andrew Bazeley @ The White Bear

Andy Fawthrop

Another great afternoon in The Vize for free music. Be rude not to enjoy it!

After listening to Proms In The Park with the Devizes Town Band (see report elsewhere in Devizine) I headed back into town, and to the White Bear to catch Andrew Bazeley.

Andrew is, quite simply, a Blues fanatic – Delta Blues, Country Blues, Traditional Blues, Bottleneck Blues, Acoustic Blues – whatever you want to call it, this is your man for playing it, singing it, learning about it, teaching it, writing about it, and even giving all-day lectures about it! What Andrew doesn’t know about the history of the Blues, the US Deep South, and the history of guitars, is simply not worth knowing.

baz

Andrew cuts a distinctive figure, balding and sporting an impressive grey-white beard, and it’s fairly obvious that he’s a child of the sixties. That’s when he acquired his first guitar, and he’s been singing the Blues ever since.

On Sunday afternoon, he kept the talking to a minimum and just let the songs flow out. Swapping between his two guitars (one 101 years old, the other a mere 82 years old), the music just kept coming. Most of his set was traditional material from the likes of Robert Johnson, Charley Patton, Blind Willie Johnson and others, but there was also a few of his own self-penned numbers seamlessly worked into the set.

His sets were assured, well played and well sung, to the obvious enjoyment of the audience as it built up during the early evening.

Another very pleasant afternoon spent in the White Bear, and another tribute to our great little down for providing a whole afternoon of free musical entertainment. Happy Days!

Coming up at The White Bear on future Sunday Sessions @ 5pm are:

• 22nd September Jamie R Hawkins
• 29th September Fraser Tilley


© 2017-2019 Devizine (Andy Fawthrop)
Please seek permission from the Devizine site and any individual author, artist or photographer before using any content on this website. Unauthorised usage of any images or text is forbidden.


Adverts & All That Kinda Stuff!

KnKY-logo-No-Reading-2018-1024x184sigriffposterCarmen A5 Flyer.inddfamesoundaffpelicanknat19psagimmienewadvertadpelican2bigyellowswinfemale201965217389_1310844582401986_2449299795982942208_o

Rock Hopping in the Free Rowde

When apathetic to galivant to a gig, and not for want of staying in my village, there’s always the Cross Keys in Rowde. Hum, been a while, historically had its ups and downs. Last report I did here things were looking up; food-wise, a few craft fairs and various goings-on. But it’s changed hands again, and the one thing it lacked other than the sporadic Splat of the Rat, live music, has returned to the agenda by the new landlord.

Arm twisted, I’m back in the watering hole where I had my wedding reception and the kid’s christening parties. Little visually has changed, punters included. No bad thing, village hub. The landlord tells me they’ll be renovating the restaurant area, but if it isn’t broken. For the functional the main pub is perfect, aesthetically it’s apt. Although the change for the evening is the pool table area, where guitars and drums swim amidst wires and foot pedals. Devizes band Rockhoppaz are due to kick off a season of performances here. This is good, heard of but not seen these guys yet.

rockhoppaz2.jpg

Holding a preconceived idea, largely based upon the name, I was mistaken to assume I’d be knocked over by rock verging on metal, which though not my cuppa, I’ll endure to support live music in my village for sure. Pleasantly surprised then to hear this matured four-piece’s repertories, though while varied, were largely based on rock and punk-mod classics.

Tuning teaser being Johnny B Goode, the age range of songs went from contemporary back to rock n roll. Commencing with the Kaiser Chiefs, we heard Dandy Warhols and Primal Scream covers, we were cast rearward to Buzzcocks and The Jam, and plopped into a pinnacle of Rolling Stones and Kinks. It was this era where I thought the band reigned, with an awesome Brown Sugar. Yet the range was achieved in its entirety with equal passion and skill, but when lead singer, Jim Smith rolled out an adroit version of Neil Young’s Rockin in the Free World, I changed my mind.

I questioned this namesake preconceived idea to the band during their beer-break, pointing out drummer, Ian “Tef” Martin’s AC/DC tee-shirt. Oh yes, I was told, they’ll be playing an AC/DC cover in the second half. What ensued was a potentially everlasting musical trivia conversation, indicting their passion was their motivation, and herein lies the spirit of Rockhoppaz, I feel.

They’re not the next big thing, just a bunch of guys satisfying an appetite on the pub circuit, but as far that notion travels, lead Jim Smith, aforementioned drummer Ian Martin, guitarist Chris Downing and “Big” Ben Robinson bassist pull to its bumper, and would do your function a huge favour, for their thirst and talent rubs off on the audience; punching above the average pub circuit band’s weight.

In various incarnations they’ve been around for a while, previous band names being more profane, they say, causing me to think they once had a punk vibe about them. They’ve played the Opportunity Centre charity fundraiser at Wadworth Brewery, The Yeoman, The George in Frome, Melksham’s Pig & Whistle and our trusty Southgate, they’ve gigged the Midlands, Windsor and Bath. The Cavalier, Devizes has them on November 2nd, their next local gig.

xkey1

As for the Cross Keys, I hope it’s the first of many, and with the great pub-grub and Sunday roast menu retained, I wish them all the best. The landlord calls for more, monthly, with local mod-rockers, Cover Up appearing next. I’d like to see some local heroes with some original acoustic booked too, happy to recommend the usual suspects. There is a notion cover bands will undoubtedly satisfy the regulars at The Cross Keys, but said originals will bring others in. It’s not a long walk from Devizes, I do it the other way many weekends, and that’s uphill, pal! That said though, getting a bit autumny innit, so nice to know live music has extended out to Rowde.


© 2017-2019 Devizine (Darren Worrow)
Please seek permission from the Devizine site and any individual author, artist or photographer before using any content on this website. Unauthorised usage of any images or text is forbidden.


Adverts & All That Malarkey

KnKY-logo-No-Reading-2018-1024x184sigriffposterbigyellowswinsoundaffpelicanknat19Carmen A5 Flyer.inddgimmiepelican2newadvertad65217389_1310844582401986_2449299795982942208_ofemale2019

Bizet’s Carmen at Lavington

White Horse Opera will be performing Bizet’s Carmen at Lavington School Wed 30th Oct, Fri 1st & Sat 2nd Nov at 7.30pm.

The secret of Carmen’s success is its excitingly exotic setting in and around magical Seville, its devastatingly passionate story charting the downfall of two people pole-axed by love, and the ravishing music whose impact is both immediate and lasting.

Paula Boyagis plays the fiery, seductive gypsy Carmen, Don José is being played by Phillip Borge who is flying in specially from Gibraltar! Barbara Gompels plays Micaela, his childhood sweetheart. The dashing bullfighter Escamillo will be played by Jon Paget.

Fully staged sung in English with an excellent professional orchestra.

Carmen A5 Flyer-back.jpg

Tickets on sale now from Devizes Books and online at
www.ticketsource.co.uk/whitehorseopera

Book early to avoid disappointment.


Adverts

sigriffpostersoundaffpelicanknat19famebigyellowswinpsagimmieKnKY-logo-No-Reading-2018-1024x184female2019

newadvertad

Honest in Devizes: Ed Byrne Arrived in Devizes!

As an inexorable drunken dancer, have to steer clear of musical events on a school night at my age. I figured this wouldn’t be so bad; sit in the Corn Exchange, listen to Ed Byrne telling a joke or three. I didn’t weigh in the chance my ribs would be hurting in the morning and I’d still be grinning like a madman at the intricate weaving of observation comedy, yet they were, and I was, during my dark morning shift. This was, simply 250% side-splitting.

I had psychologically amassed hype in my mind, feeling like I’d been sitting in our grand hall since June waiting for this guy to show. Undoubtedly the only disappointment at this summer’s Devizes Arts Festival, Margaret announcing Ed’s car had broken down and he wasn’t going to make it, turned into a bogof for the punters. If we chuckled at the proficient two support acts in June, and we sniggered at Canadian comedian Paul Myrehaug on this occasion, there’s a clear distinction between the support comedian and a name like Ed Byrne. I have to hand it to Devizes Arts Festival for bringing such big names to our little town.

paul (51 of 122).jpg

Ed compered the show, popping on first to run a few annotations surrounding the unfortunate circumstances for his truancy in June, which although I’d anticipated, did it in such a hilarious manner it served as the perfect taster for what was to come. He introduced Paul Myrehaug with negative banter. A winner of the 2007 Yuk Yuk’s Great Canadian Laugh In, and second place in the Seattle International Comedy Competition in 2006, Paul is now a regular on the UK circuit and supports Ed on this “If I’m Honest” tour. He delivered amusing anecdotes with natural flair, verging somewhat on crude, but executed courteously. Taunting one member of the audience, and effortlessly treating testing gags on us as part of his act, distinctively he owned the stage with magnetism.

Aptly titled, Ed Byrne’s If I’m Honest never ventured into politics or current affairs, matter-of-factually threatening to bore with Brexit at one point remained but a one-liner. This was an elaborate interlacing of observational comedy and rumination, topics relating to family life and its subsequent cultures. With frank veracity that his children aggravate him a in manner others are unqualified of equalling, he concluded the inaugural with the unpretentious reason for this; their traits remind him of himself.

IMG_2794
Seriously shaky images from Devzine, except no substitute 

From here he jests his self-esteem, expresses contempt for his own character, progressing into pondering precisely what qualities he has which he would like to pass on to them. At its pinnacle the routine examines his own liabilities, laying into copious cultural references from his past. This worked wonders for me, being only a year younger, I identified with his thoughts on the eighties Superman movie and like him, I wished for a Big Trac, which, thankfully looking back on it, never appeared under a Christmas Tree.

With spellbindingly funny narrative, it moves swiftly, to contemporary culture engulfing his kid’s life, his abhorrence for online irritations and the interminable enticement to sabotage his career by daring himself to yell inappropriate language on Facebook or The One Show. If the great Billy Connolly mastered returning to previous points the audience may’ve forgotten about in the constant stream of bullet points, Ed Byrne nurtures this skill proficiently, and projects an non-stop laugh-out-loud show.

IMG_2795
What? I was laughing too much to steady a camera

Far from being the end to this year’s Devizes Arts Festival though, as their gallant effort to bring us big named stars continues into November, with a highly-anticipated one-off show from legendary R&B singer and keyboardist, Georgie Fame, I will not hold my breath for next year’s line-up until I’m done dancing to Yeah, Yeah; so I’d advise you grab tickets for that asap!

fame


© 2017-2019 Devizine (Darren Worrow)
Please seek permission from the Devizine site and any individual author, artist or photographer before using any content on this website. Unauthorised usage of any images or text is forbidden.


Adverts and all that malarkey!

10pmixuppostsigriffposterclock13thkickers2soundaffpelicanknat19bigyellowswinpsanewadvertadvinylrealmfemale201965217389_1310844582401986_2449299795982942208_o KnKY-logo-No-Reading-2018-1024x184gimmie

Sam Bishop’s New Single; Cry For Help

Commencing with a captivating piano which takes me back to the swashed soft metal surge of eighty-seven, and Heart’s Alone, I’ve Sam Bishop’s new single “Cry for Help” rolling. Sam hasn’t the big hair for soft metal, neither was around to swagger in the school disco, slurping the drunkest floosy to this endearing power-ballad finale, praying the teacher doesn’t notice the bottle of Cinzano hanging from his back pocket. This meagre comparison stops at the opening, it doesn’t explode with wailing guitar, no hairband needed. Suffice it to say though, this release of passion has a similar craving in its narrative, and the comparison itself perhaps just an excuse to relive my school disco days!

sambis2

The heartache of saying goodbye to a summer romance is a theme used before in Sam’s songs, particularly in his duo Larkin, though Sam claims this to be “the most heartfelt and vulnerable song I’ve ever penned.” In line with this, skip a decade to the boybands of the nineties, and you have yourself a more justified assessment, yet lyrically is one of Sam’s best to date.

Talking of goodbyes, it’s a shame to hear Larkin’s gig last Saturday at the Pilot was the last for some foreseeable time. Sam and Finley announced this week they’ve a “multitude of other projects and focuses that means keeping the band going at the minute is something of a struggle.” While Fin is enjoying local gigs as one-half of his family duo, The Truzzy Boys, Sam is studying music at college and exploring and pushing the confines of his talent as recorded music.

larkinfeat

We spoke to Sam exclusively on the dawn of his previous single, A Thousand Times, in which I described it as, “a breezy indie-pop affair, dour and atmospheric with that theme of heartbroken youth so apt for Sam’s hauntingly distinctive vocals.” Cry for Help is similar in said atmosphere, even theme, however reigns more pop ballad than perhaps indie. I wonder if it’s harking back to 98 Reasons, his school boyband days, adding maturity but aiming for emotive commercial pop. Given the choice, I’d favour A Thousand Times, but I appreciate I’m not within the target audience of this new single, and if I cringe at pop mush overkilled on Heart FM, this single has much more clout than the archetype.

Upon hearing this, I consider many teenagers swaying to it at an under-18 holiday camp, saddened by the parting of weeklong friendship made, and fading memories of a sugar-coated snog behind the laundrette block. Yet without the cliché of Careless Whisper, without the slush of Wet Wet Wet, Sam, I reckon has made a brave and bold attempt to cross this border, a genre which sells like a bucketload of hot cakes.

Cry For Help by Sam Bishop is out this Friday, 13th September.


© 2017-2019 Devizine (Darren Worrow/Nick Padmore)
Please seek permission from the Devizine site and any individual author, artist or photographer before using any content on this website. Unauthorised usage of any images or text is forbidden.


Adverts & All That!

KnKY-logo-No-Reading-2018-1024x184pelican210pmixuppostsigriffposterfamenewadvertadbigyellowswinfemale201965217389_1310844582401986_2449299795982942208_o

Forty Years of The Wharf Theatre, we look forward as well as backwards.


imagesQK622M0N

Now a trail of leisurely pursuits, remnants of an industrial thoroughfare are still visible on The Kennet and Avon Canal. While some lay dormant and dilapidated since its decline in the 1850s, many have been put to good use. Enhancing the tourist attraction, cafes and inns make use of warehouses and wharfs, but none perhaps as much as the small, 18th century warehouse, adjacent to the Kennet & Avon Canal Museum at the Devizes Wharf.

It’s been home for The Wharf Theatre for the past forty years, officially opening on the 16th May 1980 with a production of J B Priestley’s When We Are Married. Prior to purpose-built arts centres, Devizes was the only local town with its own theatre, and it remains the only dedicated theatre in East Wiltshire.

images87Q1HQ8U

Formed in 1947, The Devizes and District Amateur Dramatic Society, were never happy using the Palace Cinema or Corn Exchange, and though it gave them the name Wharf Theatre in ‘73, even the first premises in Couch Lane was unsuitable. It’d take another six years before Kennet District Council redeveloped the Wharf, and the site as we know it today was reserved.

Handy, perhaps that the then treasurer, John Hurley, was former assistant chief executive at Kennet District Council, but the fact we have our own theatre is largely due to him and wife Beryl. However, if you think the theatre is all a bit hoity-toity for you, consider it was renovated with labour provided by youth, under a Job Creation Scheme, and part-funded by the Manpower Services Commission, a quango addressing unemployment. It’s said all members chipped in to help, working alongside offenders on community service!

legallyblonde1

If you’re still not convinced, thinking this is all before my time, (me too, honest!) stick around as Devizine wishes the Wharf a happy 40th birthday, and with their autumn-winter season brochure out, highlight what’s happening over the coming season. With an incorrigible womaniser, ghostly horror, an amateur boxer and a pimp, skiffle and comedy songs, flap-tastic family comedy and pantomime, oh, and Boycie, there may be something for you.

wharflshop2

It starts 23rd -28th September with a ghost story, and everyone loves a ghost story. The Turn of the Screw, which we previewed here.

turnscrewwhatrf

On Friday 4th October they trace back a plethora of comedy songs. Probably The best Comedy Songs in the World Ever…. Maybe! covers a history of comedy songs, from Noel Coward and Lonnie Donegan to Monty Python and The Goons. Bernie Cribbins is in there, and of course, if they need any props for the customary Benny Hill song, I’ve a milk bottle or twenty.

ProbablyTheBestComedySongs

Also note I can do a cracking impression of both Boycie and Marlene, but not to order. John Challis has an audience with on 12th October, revealing on-set secrets from Only Fools and Horses and the actors Sir David Jason and Nicholas Lyndhurst. You know this one makes sense, Rodders.

OnlyFools_Boycie

Comedy a running theme for the early autumn, Alan Ayckbourn’s Living Together runs from 21st to 26th October, introducing us to the incorrigible womaniser, Norman, and his family of recognisable middle-class types whose personalities are never quite as predictable as they seem.

DuncanNovelle_MaggieRegan - Copy

One of the UK’s beloved comedians and impressionists, Duncan Norvelle and award-winning singer and entertainer, Maggie Regan visit the Wharf Theatre on November 1st. Combing eccentric humour with high energy roots music, it’s all funny songs, crazy costumes and virtuoso music with The London Philharmonic Skiffle Orchestra on Friday 8th November.

SkiffleOrchestra

In residence at Pound Arts, Corsham, but taking their show internationally, expect flap-tastic family comedy, when The Last Baguette Theatre Company presents The Bird Show on the 9th. Suitable for the “whole brood,” including fledglings from three plus, this madcap and touching show about birds facing changes to their habitat uses live music, puppetry and lots of silly bird jokes.

TheBirdShow

Now, I don’t wanna think about it just yet, sure you don’t either, not while the sun is still shining, but the big C wouldn’t be the big C without pantomime, and the Wharf has Cinderella running from Friday 6th to Saturday 14th December.

Cinderella

New decade, 2020 then, and nobel laureate Harold Pinter’s Tony Award-winning 1964 two-act play, The Homecoming runs from Monday 27th January to Saturday 1st February. Directed by Lewis Cowen, this is vintage Pinter, but its twists are worthy of Alfred Hitchcock.

TheHomecoming

When Teddy, an expatriate American philosophy professor, brings his wife Ruth to visit his old home in London, he finds his eccentric family still living in the house; his father, a retired butcher, his uncle, a chauffeur and his brothers, an amateur boxer and a pimp. In the conflict that follows, it is Ruth who becomes the focus of the family’s struggle for supremacy.

With a rich history, notable past performances and maintening an eminent yet pragmatic, hospitable atmosphere, The Wharf Theatre is something for Devizes to be proud of. Check the website for more details of performances and tickets.

untitled


© 2017-2019 Devizine (Darren Worrow)
Please seek permission from the Devizine site and any individual author, artist or photographer before using any content on this website. Unauthorised usage of any images or text is forbidden.


Adverts & All That Malarkey!

KnKY-logo-No-Reading-2018-1024x184famesigriffposter10pmixuppostpelican2newadvertadvinylrealm65217389_1310844582401986_2449299795982942208_ofemale2019

Gigs and Festivals for September

Ah, nuts, it’s all over. Get your winter coat, hats and snow shovels and bolt down the hatches; it’s September. “We know that in September, we will wander through the warm winds of summer’s wreckage.” Back to school though, summer usually kicks in around now. So, gig-wise, here’s what we’ve got to warm your soul.

Note, this is for musical gigs, please keep up. Last month I did this people were arguing I forgot their flower pressing show, foot healing festival and stuff like that. Please consult our homepage for it’s THE most comprehensive event guide in these dark waters, even if I do say so myself. Yeah, no, yeah-no, there’s all kinds of stuff listed to do, family stuff, sporty stuff, arty stuff, stuff with stuff in it and all the stuff between. And what is more, it’s updated nearly every day, so keep your eye on it, ‘n’ stay in the know.

Thursday 5th – Sunday 8th

Starting midweek, as I’ve procrastinated this weekend; man cut lawn. Regular acoustic nights on Wednesdays at our dependable Southgate, Devizes, and there’s an open Mic at The New Inn, Semington.

amyspace.jpg
Amy Speace

Thursday 5th then, and all I have to date is that American singer-songwriter and one third of acclaimed Americana harmony trio Applewood Road, Amy Speace will be returning to Sound Knowledge, Marlborough to promote her new solo album. Me And The Ghost Of Charlemagne is produced by long-time collaborator Neilson Hubbard and recorded during the final weeks of pregnancy with her first son, capturing Amy at her most honest, with sparsely-decorated songs which double down on her larger-than-life voice and detail-rich song writing. Amy will be playing a short set in the shop and signing copies of her album from 7pm on Thursday 5th September.

Friday, and aside the popular karaoke nights, we’re glad to see The Pelican in Devizes opening up for live music, this should become a regular free venue, and bands are encouraged to get in touch with them. What better way to kick off the proceedings than with Devizes-own Funked Up?

pelican1

Now, I know my boss at work has a hand in this one, and going on the thought I’ve never seen anyone more dedicated to one particular band than him, I mean it’s an obsession to the point he talks of little else, I have total faith if you like Thin Lizzy, this will be the ultimate tribute band to catch. 4-piece, Twin Lizzy play The Cavalier on Friday, with all the classics that you would expect, but also, they claim to “mix it up with some key album tracks for good measure.” Including a genre-related disco, this is the ideal opportunity to check out the Cavy. It’s booking get evermore diverse, with country and rock, to kid’s discos and a plethora of top pop tributes.

twinliz.png

Meanwhile in Swindon, those old-time musical hall, sixties psychedelia and new world country blenders, The Astral Ponies storm the Castle. Least they say “the Astral Ponies politely asking if people would like to come along and enjoy some fine and joyous music with them,” is more suitable. If vintage punk-rock is more your thing, try The One Chord Wonders at the Rolly. Metallers think The Queen’s Tap, with Rorkes Drift, or the Vic where Ion Maiden play; stop head-banging for a second a re-read that, yeah, s’ a tribute.

But if you’re still hunting for festivals, Crash the Festival is in Andover direction, KV Brass are followed by Humdinger on the Friday and Kova Me Badd on the Saturday, roundup the Burbage Beer Festival, on the Red Lion field. The other way, Saturday 7th sees a one-dayer at Marshfield; Marshfest brings together popular Hip-Hop act, Stay Hungry, five-piece rhythm & blues combo Haney’s Big House, indie rock with The Temple Keys and Falling Fish, blues band Antalya, soul-funk with Eden, rock with The Clones, to name but a few. If this doesn’t convince you, Devizine favourites, Train to Skaville are also booked.

drywhitebones
Dry White Bones

Devizes, make your way to the Southgate, Dry White Bones accompanied those Boot Hill Allstars last time I saw them, and it wasn’t nearly for long enough. After a stint at Glasto, it’ll be good to see this duo headlining. Larkin play Melksham’s Pilot, and for folky pop songs, Scratchy Black Cat at Stallards, Trowbridge is recommended.

There’s a Big Get Together at the Neeld, which aims to bring over 50 local clubs and organisations together in one place, to provide a showcase of activities that will encourage people to participate, get involved and expand their social life. Free event. Staying in Chippenham, soprano, Susan Coates, Mezzo- Soprano, Marie Elliott and Concert Pianist, Nick Goodall presents a mix of famous solos and duets from the world of Opera, Broadway and The All-American Songbook at the Cause. Or, rock out with Homer at the Black Horse.

Ska-punk in Swindon, as Operation 77 play Level III, or Led-Into-Zeppelin are at The Victoria.

Sunday, Devizes Town Band takeover Hillworth for the Children’s Proms in the Park, or maybe catch The Everly Brothers and Friends Tribute Show at The Neeld.


 

Wednesday 11th – Sunday 15th

Acoustic jam down the Southgate Wednesday, Thursday in Devizes is all about Mirko’s band, 10p Mix-Up, playing the Cellar Bar from 8pm. In aid of Liam’s fund, please support this one if you can. I interviewed Mirko recently, which covers the gig fully, so check here.

10pmixuppost

Meanwhile George Wilding and Plummie Racket support Johnny Lloyd, at The Vic, and Chris Webb does an acoustic set at The Tuppenny, Swindon.

Friday 13th has a good variety of local music, that danceable duo, The Truzzy Boys play The Crown, while our other own indie upcomers, Clock Radio are welcomed by The Southgate. People Like Us nip over to The Seven Stars at Bottlesford, the Chaos Brothers at The Three Horseshoes in Bradford, and The Skandals play The Vic in Swindon.

cloe.jpg
Chloe Jordan

For an evening of classical music, try the Corn Exchange on Saturday, where two fabulous local musicians, guitarist Andrew Hurst and soprano Chloe Jordan will take you on a journey through a range of music from the medieval to now. There’s a unique original melodic rock band from Glastonbury at the Southgate called The Truthseekers, and favourite rock cover band, the Rockhoppaz play The Cross Keys, Rowde.

The Pilot in Melksham host a live music event for RUH Forever Friends, including Sound Affects, Burlington Underground, PSG choir, Plan of Action, Sarah Deer, Heather Kerr, Naomi Charles, Chloe Brewer and Tyler Bartlett. Meanwhile, the Assembly Hall has Cliff Richard tribute, Simon Goodall.

While the 2Tone All Ska’s are at The Woodlands Edge, and Level III Punk the Club, there’s a beer, cider and music festival at Wichelstowe, in aid of Wiltshire Air Ambulance, still awaiting the lowdown on this, but rumour has it Lottie J and other Marland favs will be playing. Vinyl Realm is at the helm of this one, and after the amazing show at the Street Festival, I’m expecting this to be a good one.

lottiejfeat
Lottie J

Wow, The Human League are playing Bath Racecourse on Saturday, but Reggae though? Check those Urban Lions at the Woodbridge Inn, Pewsey, or Train to Skaville at Warminster’s Prestbury Sports Bar.

IMG_2760
Train to Skaville

Ah, we’ve reached the end of the first fortnight, I’ll update this with the following one later, best get this out now so you can plan ahead. Round it up, Sunday the 15th in Devizes where George Wilding supports The Strays at The Cavalier, or The White Bear continues its Sunday sessions with Andrew Bazeley.

Treat this as a guide, though, not a bible; more gigs and events of all kinds are updated on our homepage and Facebook page too.


© 2017-2019 Devizine (Darren Worrow)
Please seek permission from the Devizine site and any individual author, artist or photographer before using any content on this website. Unauthorised usage of any images or text is forbidden.


Adverts & All That!

KnKY-logo-No-Reading-2018-1024x184

sigriffpostercoucilroadshowtaste10pmixuppostnewadvertadbigyellowswinbigjamvinylrealmfamefemale2019

The Relevance of Mike Barham

After a “knackering weekend” Devizes music scene’s gentle giant rests up, prepping for All Roads Lead to Frome on Saturday, where he’s one of twenty acts to be thrown onto the Cheese & Grain’s stage. He sends me Relevance, new single, out tomorrow (30th August) telling he’s “been sitting on it for like, two years, never got round to recording it, and over the summer hols I just thought; you really should give this a go, otherwise it’s just a stopper in the pipe.”

Have to rub some stubble, yes, literally have a number of them myself. Often apposite to stockpile ideas, but creative tend to doubt them the longer they linger. Yet every now and then, your scrapbook is worth browsing, dust off a rough and finish it.

“Exactly,” Mike agrees, “it’s one of those things I just needed to get off the mental shelving you know? Not a clear-out, because it’s no good, but more like; stop resting on my laurels and progress!”

Pardon the pun, but relevance to that conviction, doubled with the notion he confesses nerves writing, recording, mixing and releasing this solo single by himself for the first time, Relevance is not only Mike on his best behaviour, it’s a prodigious single, emotive and fuller than anything you may previous have heard from Mr Barham.

mikebar
Image by Nick Padmore

Maintaining those grating bluesy vocals, for those familiar with his fiery debut album, Altitude with Attitude, expect later, acoustic tracks Signal Fires or Short, Never Forgotten rather than the blast of Bowser’s Castle or The Cider Song. Yet, think more evocative and shadier, a ripened Mike Barham, perhaps, after all we were talking about last week down the Southgate too, Mr B!

“It’s a bit of a mellower direction,” he describes, “reflective but no less direct lyrically I feel, sort of a City and Colour/Death Cab for Cutie vibe, very simplistic with just vocal, acoustic and one electric for texture.” It works for me, I envision Phil Cooper tipping his porkpie hat to its expressive maturity, and Jamie R Hawkins nodding approval at its narrative too.

Alongside working with his band Nerve Endings on some recorded material, here’s a poignant solo single which stamps Mike firmly on scene. If it’s with Nerve Endings, or solo, Mike Barham will entertain a crowd, undoubtedly, but here’s something with more universal appeal. Least I reckon, you’ll have to hear it for yourself.


© 2017-2019 Devizine (Darren Worrow)
Please seek permission from the Devizine site and any individual author, artist or photographer before using any content on this website. Unauthorised usage of any images or text is forbidden.


Adverts & All That!

KnKY-logo-No-Reading-2018-1024x184fromesigriffposterpelican110pmixuppostbigyellowswinvinylrealmfamepelican2female2019newadvertad

Street Festival, Yeah!

Images used with the kind permission of

Tanya Jurkiewicz Photography

and Gail Foster

 

Gigantic bouncy slide outside the trusty Pelican, where we usually wait for a bus. Beyond, a superior stage surrounded by pockets of circus acts, charity stands, clothes stalls, and street food heaven wraps the Market Place, where DOCA gave information and a Pimms bar bustled. Happenings snaked down Snuff Street, over St Johns, and across the town centre, the atmosphere buzzing. What’s not to like?

gail7

From fudge and churros, to Tibetan cuisine and crocodile burgers, food and drink was diverse. Stealth Brewery held the most aesthetic bar and seating area, The British Lion occupied the other, functional side, frantically serving the cider which gives this event it’s local auxiliary namesake. Yes, Black Rat Monday, or as the wonderful organisers would favour you call it, The Devizes International Street Festival. Upon us, the customary bubbliest, most multicoloured and all-round brilliant community-fuelled event to bless our spirited market town.

tanya3

If many a festival constitutes packing camping gear, blagging petrol money off mates and trekking through town and country to attend, DOCA bring the spirit of festival to your doorstep, and do it with bells on. As the crowd bobbed and gyrated at the main stage, I spotted a musical statue, poised to snap a photo, or ten. Gail turned to me with a smile, “it’s my favourite day of the year,” she uttered. Whatever I write of it will be deficient and incomplete, for there’s so much going on. It’s our Mardi Gras; you wander, you catch what you can, go where you like, impossible for me to document it all, especially half-toasted as I was! Gail summed it in a sentence.

tanya5

As the sun shone, I must say yet again, this was the fantastic event it traditionally always has been, and improves annually. Impossible to stage something so vast and varied without slight hip-cups. I’m not rising to grumpy hecklers taken to Facebook to whinge their futile vendetta against DOCA, all over a carnival date change so volunteers can take a well-earned break and schools can be encouraged to participate. Drunkenly calling for the artistic director’s head on a platter, as if they were the manager of Newcastle is pathetic. Did you slip through a wormhole and appear in an alternative reality, because I thought it was awesome? Take your storm in a teacup to Rio, least upon return from Lalaland give yourself the directive to resist the urge to post when sozzled!

tanya1

Ha, an opinion piece it be, refraining from writing journalistically as I do, it’s my belief we should praise DOCA, award the highest accolade. This weekend was tremendous. Budget didn’t stretch to quite as many cosplayers, walkers and random street theatre than previous years, something funding will help towards, or hey, the attendees maketh the festival; maybe dress up yourself! No Andy; Spiderman onesie is in the wash, thank you!

gail8

My attention was drawn to an apparent lack of activities at the Northgate end, usually the child-friendly zone. I’ll say Sunday on the Green is more geared towards our younger, still it’s fair feedback. Though, it’s all the criticism I will accept as constructive. Yes, unobtainable was sitting around The Market Cross; it was fenced off due to structural damage and danger of pieces falling; no fault of DOCA. Similarly, a band mistaking their performance time is an unavoidable calamity. This caused a rather vacant period on the main stage, which was a shame, yet well-oiled crowds laughed between themselves, and thus away with the fairies went such trivial issues.

gail4

However, it did mean many flocked past the Town Hall, an area which usually fizzles out back to the reality of everyday Devizes. I’m so happy to say, prompting DOCA to take onboard our local music scene, I suggested something I really couldn’t commit to; had to work in the morning. But it was so, that Pete of Vinyl Realm had similar ideas, and executed a second zone of music in a manner I couldn’t have. My dream to have a little marquee with some acoustic singers was transformed into not only a trailer stage, but acoustic area and vinyl DJ, adding that extra dimension and rounding off the festival site with a definite border.

daydream3

It was here where some excellent sets played before an audience larger than we anticipated. Strange Folk were amazing, yet it was Daydream Runaways who really bought the stage to its pinnacle. Sweltering, this upcoming pop-indie amalgamation of Swindon and Devizes, who I’ve been hailing with praise since I discovered, really delivered an energetic and proficient set of favourite covers and their own accomplished originals.

daydream2

Often supporting the guys, Ben Borrill acoustically owned the area next, followed by Devizes space-rockers Cracked Machine. Having not managed to catch this headline act live up till now, I pondered if they could recreate the sublime atmospheric ambience they do on record, and I was not disappointed. This Pink Floyd of the vize volleyed it out of park. With trickles of intoxication, the sound apt under the heat of the sun, the crowd were whisked away blissfully.

 

This was, quite honestly, a highlight of the day, the whole idea to have the second stage was. So, a massive respect goes to Pete, Jacki and all at Vinyl Realm for organising and funding this, and to the Lamb who supplied the power, in more ways than one; I saw Sally wander over to band to hand them all some well-deserved hot dogs!

 

If this doesn’t convince DOCA to support our local music scene, nothing will! Pete has already suggested interest in doing it again next year. But, feeling the need to cover as much of the festival as possible, I scarpered back to witness the most gorgeous African fusion band on the main stage. Blinking heck, s’ all going on, so much so, it’s going off.

gail2

Truly fantastic DOCA and everyone who contributed their share, worked the bars, hosted side stalls and attractions and of course, the bonded spirit of you, the revellers; dotted with the special events, leaving next weekend for Confetti Battle and Colour Rush, I call to embrace this change, as this is destined to progress annually, we should be the envy of all of other towns and be proud of what has been achieved this weekend.

tanya2gail8gail6gail5gail3gail1tanya6tanya4daydream


© 2017-2019 Devizine (Darren Worrow)
Please seek permission from the Devizine site and any individual author, artist or photographer before using any content on this website. Unauthorised usage of any images or text is forbidden.


Adverts & All That!

devizintstreetbronteudelsigriffposterflyingmonkpelican110pmixuppostfametamsinscandalbigjambigyellowswinpelican2vinylrealmnewadvertad65217389_1310844582401986_2449299795982942208_ofemale2019

Q: What’s in the Yurt, DOCA? A: Los Galindos’ Udel

Images used with kind permission of Gail Foster

 

For me it’s not enough to say something is “weird.” To start, is it a “good” weird or a “bad” weird? If the opposite of weird is normal, and normal considered boring, then weird must surely entertain. It’s subjective; depends where you sit on the border of what constitutes an acceptable limit of weirdness. When it goes beyond this level maybe it fails to entertain you, by being so weird you cannot process any logic or reason within it, ergo “bad” weird, in your opinion.

Yet illogical or plain nonsensical has always been a backbone of humour. Many strive to extend said border, for if Spike Milligan or Monty Python pushed the limits in surrealism, Miguel de Cervantes did too, 350 years beforehand. I’d suggest there’s something very Don Quixote about Los Galindos’ Udel.

los2

Humour at its most basic level is visual, a baby will find perpetual peek-a-boo hilarious. Similarly, visual humour relies on those classic formulas; falling over, sudden disappearance and reappearance and dumbfounded surprise. Akin to silent movies, voices are minimal and slapstick in Los Galindos is bountiful, and executed with distinction. But it is weird.

See, I like weird, strive for weirdness, savour weird things, chat to sane people hopefully making me appear weirder. Perhaps I set the barrier of what constitutes too weird high. If you agree, you will love this show. If you’ve wandered past the Green and seen a Mongolian yurt and thought, well how is a circus act supposed to be staged in there, without spoilers I’ll enlighten; that’s part of the joke.

If you’re thinking where does this article stop being a thought on the word weird, and become a review for this fantastically curious show, then you’re already putting barriers at your chosen level. For I don’t want to ruin the surprise, for the show continues through to Monday, but it left me wondering at what point the show actually started. Could be as soon as everyone was seated, even when we were kindly ushered in, perhaps just outside the door. Maybe all walking past, contemplating said notion, well how is a circus act supposed to be staged in there, have already become the audience of sorts.

los3

It’s a prime example of what I’m getting at, the act is the production, the production is an act, the props are parts of the stage and yurt, and the yurt, stage, and possibly the audience too are the props. The costumes and overall impression are modest, yet charming. The acrobatics are deliberately played down like Tommy Cooper’s magic, but are exceptionally skilful.

Wrapped in essence of a humbled, poor circus family, who overdramatically welcome you, their efforts to make you comfortable and enjoy their show is the clowning element, perhaps it’s only narrative. The hazard of these disguised clowns executing daredevil circus stunts within inches of your face is worrying, and part of its attraction which will leave you in awe.

If you’re the sort expecting a traditional request, “I need a volunteer from the audience,” disregard your expectations. This is a unique and original take on circus noir, it’s clowning and acrobatics combined in a manner leaving you spellbound and pondering what exactly just happened, and why.

los4

There was a point in the act, without giving the game away, where the doors blew open, and in viewing a glance outside there was a gentle reminder you were sitting on the Green in Devizes, and not immersed in a scene from Don Quixote staged by amateurs with a homemade theatre, in some remote mountainous village north of Barcelona.

It’s fantastically abridged circus, something radical moulded into a Mediterranean era of yore, and honestly, something you’ve not see in Devizes before, or probably ever will again, even if you consider Devizes is weird!


© 2017-2019 Devizine (Darren Worrow)
Please seek permission from the Devizine site and any individual author, artist or photographer before using any content on this website. Unauthorised usage of any images or text is forbidden.


 

Adverts & All That!

devizintstreetudelbronteman1000argyflyingmonkKnKY-logo-No-Reading-2018-1024x184tamsinscandalbigjamsigriffposterpelican1pelican210pmixuppostbigyellowswinnewadvertadvinylrealmfemale2019fame

A Scandal with Tamsin Quin!

There are two sides to every story. We’ve heard Dolly’s angle since 1973, imagine if Jolene had her say. Traditionally, like gallant fables, songs seldom back the underdog, the aberrant. Particularly the rounded narrative of folk or country, usually tales culturally able to be retold, optimistically.

If the last local singer-songwriter you’d expect to be exploring darker tenets is Tamsin Quin, think again. Akin to Springsteen’s Nebraska, in so much it summons no such communal feeling, rather Scandal, the new single from our illustrious local songstress is secluded in a room of a distant, shady and enigmatic place.

3crown1
Image: Nick Padmore

A song of who the cap fits, of watching your own back. Tamsin advises “there’s criminals in the shadows, pull your friends a little closer.” But cross examines her own persuasions and faith in the notion, maybe, “we’re all scoundrels deep down inside.”

It’s as if the darker depths of Tamsin’s acute words in previous songs have come to detonation; executed sublimely, and produced with eminence by Phil Cooper. Scandal, out next Friday (30th August) is whole new level of excellence for this already blossoming star. I congratulated her, as vocally it sounds deeper and much more refined than anything before. Is that what she was hoping for?

“Yep,” she responds as ardently as the same ol’ Tammy, “I was totally going for the dark country vibes. Phil did such a great job producing it; I’m really pleased with the outcome. I hope its dramatic!”

pk3

Tis indeed, like Wynette at her darkest; she builds tension around the breakfast table, the penny drops as to why Billie Joe Macalister jumped off the Tallahatchie Bridge and the protagonist attempts to hide her secret affair. “So,” I asked, “this is for a forthcoming album? Can we expect the others to be similar, or am I divulging too much?!”

“I’m aiming for a new album next year. The plan is for another single in October, then a single in February, and the album in April.” Tamsin expands the answer, “not all of the songs are this dark, although I am working on another haunting one at the moment, but the whole album feels a lot more mature that Gypsy Blood. I feel like I’ve grown into myself, and I’m writing what I want to write, instead of what I think the crowd will love. Writing more for myself I guess, although I really hope others really like it too.”

That personal enlightenment brews Tamsin’s poise when performing live, “writing things for yourself does tend to give you a little more confidence in delivery. Which I guess gives other people faith that its good, if you have faith in yourself and your work.”

n7
Image: Nick Padmore

I’m certain when reviewing Gypsy Blood, I suggested Tamsin sounded more mature, guessing both are a natural progression, though. “Guess you gotta grow up somewhen!” she laughs. I think you never stop learning and growing artistically, until, perhaps you reach a pinnacle and it doesn’t sound so progressive. Does she fear ever reaching that age where they say, “old Tamsin, just going through the motions?”

After stressing the importance to her of critical feedback, she laughed at the notion. “I guess that’s where the whole ‘writing for yourself’ thing comes in, because if you like your songs then you won’t care what people are saying.” I suspect that time is a long way off, Scandal in a nutshell is poignant, emotive and, perhaps an unanticipated gift to our music scene, and based upon it, I hold my breath for the album.

 

tamsinscandal
Click for Tamsin’s Facebook page and like for updates and gigs!

© 2017-2019 Devizine (Darren Worrow)
Please seek permission from the Devizine site and any individual author, artist or photographer before using any content on this website. Unauthorised usage of any images or text is forbidden.


Adverts & All That!

billgreengardenpartyswbddevizintstreetudelman1000bronteargyshoesfestsigriffposterflyingmonk10pmixuppostnewadvertadpelican1bigyellowswinfame65217389_1310844582401986_2449299795982942208_opelican2female2019vinylrealm

The Turn of the Screw at The Wharf

The forthcoming new season of productions at our Wharf Theatre, Devizes, kicks off with a haunting Henry James adaption they claim is not for the nervy.  The Turn of the Screw, a 1898 horror novella by Henry James, first published as a serial in Collier’s Weekly magazine, has been adapted for stage by Ken Whitmore and is directed by Lewis Cowen.

 

Running from Monday 23rd September to Saturday 28th at 7.30pm, The Turn of the Screw is set in a sprawling manor house in Bly, in the first half of the 19th Century. Henry James’ classic is one of the most famous ghost stories in the English language, and is a foundation for academics pledged to New Criticism. With contradictory understandings, critics attempt to regulate the precise nature of the evil implied. Others claim its brilliance grades its skill in creating an intimate sense of misperception and insecurity.

The-Turn-of-the-Screw-Collier's-4
By Collier’s Weekly, illustration by Eric Pape – Beinecke Rare Book & Manuscript Library, Yale University, Public Domain

Miss Grey is hired as governess to two orphaned siblings, Miles, 10 and 8 year old Flora. However, she soon discovers a dark secret and becomes embroiled in a supernatural struggle with the ghosts of the former valet and governess. She is forced to fight for the children despite fearing for her life and questioning her sanity.

Tickets (£12/under 16s £10) can be purchased from Ticketsource at: https://www.ticketsource.co.uk/the-wharf-theatre/events or at the Devizes Community Hub and Library on Sheep Street, Monday to Friday, 9am-5pm or by ringing 03336 663 366. To find out what else is on at the Wharf pick up a new Autumn/Winter brochure which is available from the Community Hub and Library and many other outlets around Devizes.


© 2017-2019 Devizine (Darren Worrow)
Please seek permission from the Devizine site and any individual author, artist or photographer before using any content on this website. Unauthorised usage of any images or text is forbidden.


Adverts & All That!

sigriffpostergardenpartyargyfameswbdflyingmonkdevizintstreetudelman1000bronte10pmixuppostfemale2019newadvertad

Teddy Bears and Market Place Parking

“I work with a lot of politicians, I talk to a lot of people on county level, at national level, and I have never come across resistance like I get from the Devizes Town Council. We go into meetings and people listen, even if they don’t agree, and we come out of it with some sort of way forward. The Town Council have simply said, ‘we’re not going to work with you,’ and completely closed the door on us. I mean, I am a pain in the backside, and a stubborn person, and that’s probably why they think I’m the devil.”

In order to play devil’s advocate to this parking in Market Place fiasco, I am having a nice cup of tea, in his shop, with a teddy bear hospital shelf, where each bear is given a bed, and a biscuit while awaiting medical attention. I ask you, what kind of demon owns such a shop?! The guy is like a big teddy himself, but local businessman, renowned for kicking up a stink, Iain Wallis, is still discontent with the way the issue is being dealt with.

As an events and entertainment guide, I favour to leave local politics to the local rag, yet the acquisition of certain town control passed from Wiltshire Council to Devizes Town Council has been delivered on an ultimatum of ending free carparking in the Market Place, now a sad reality. Proposed the area could become a lively event space, and as we stand to promote and encourage events, I confess I warmed to the idea, but not as a persuasive blanket, built on a farcical ploy. We all know, the Market Place has already been used for such, with great effect and when there is no event it functions as a carpark. The notion, if it isn’t broken, don’t fix it, springs to mind, as the community of Devizes rally akin to its own little Brexit.

With this in mind, I’m keen to hear how the subject is progressing, if at all and who better to chat to then Iain, who has not only been chief activist, but built an independent campaign for a seat on the council around the cause? Firstly though, after a tour of teddy heaven, I pondered the type of clientele Moonraker Bears attracts, surely, they wouldn’t mind paying 70p to park?

IMG_2778

“Exactly,” Iain expressed, “The problem our customers have is slightly different. It’s finding somewhere to park for long enough. Like our teddy workshops, many of them will come to sew a bear, and they need three or four hours, most parking is three hours maximum.” But he explained the issue is not directly for his customers, “for me, if people aren’t coming into town, they won’t discover we are here. So, the issue doesn’t affect my business as much as it does for others. It’s about the whole town being one entity, a community.”

So, where are we at the moment with the issue, what’s the current update?

“Difficult to answer, because they’re not really talking to us at the moment. Where we are; we have saved parking in the market place, after they were going to take it away permanently. Wiltshire Council had to change their mind, and led on that, really, despite town council taking credit. So, despite the machine not working, we saved some parking.” Indeed, it now costs 70p per hour, with a maximum stay of two, but tickets can only be gained via mobile phone, causing a stir, alongside the position of the machine by the Market Cross. I have to wonder if it’s placing is strategic; look at what happens if you don’t pay your share, you’ll end up like Ruth Pierce and the wrath of god will strike ye down!

“It’s a temporary machine,” he clarified, “it can be moved when a final design is decided. I feel that’s a little optimistic, because the information we have is even when a final design is put forward, it’s not going to happen for 12 to 18 months. What’s happened now, is the Town Council called a consultation, and take heed of each focus group. All the information has been published on the Town Council website; out of it a group of councillors came up with the two designs. We asked if we could be part of that process, but it was refused. So, we gave them time to come up with the plans.” As far as Iain is concerned, only one option is feasible, the second concerns the needed service road. “Everyone asked said, keep (the pedestrianised area) as small as possible,” as like we said, it isn’t broken.

This has happened to Melksham, the event area lays dormant, but while they have some greater amenities, and it’s only 40p to park, but face it, not as bustling or as charming as Devizes town centre. Sure, a lively space akin to Camden Market I’d welcome here, if it could be so. Yet, with this in mind, we need to be encouraging visitors, and thinking of creating more, and cheaper parking spaces, not reducing them, surely?

“Absolutely,” hail, Mr Wallis and I agree! “I think what both councils are not considering is that we have two distinct visitors using parking. Residents who live in the villages, who’s needs are to get in quick, do a few jobs and leave; they don’t want to pay, as they’re staying an hour, they live here so feel some ownership, pay their council tax to provide such services. Then you have the visitors, who, as you said, if you visit a town you don’t mind paying for convivence. What we seem to be forgetting about are the residents; we need to provide short-term parking for them, but at the same time, encouraging visitors to stay longer. This thing of having short-term carparks is crazy, we need all options.”

Iain thought signage for carparks is poor, and visitors find it difficult to find them, like Station Road. But the whole issue is beyond parking for Iain, “it’s about councils listening to the people who know what they’re talking about, those running businesses and using the town.” The origin of the word ‘text’ to connote a body of words stems from textiles. Weavers sat outside their houses because their material was too large to operate on inside, would hear the word on street and politicians would take notes from them, to incorporate into policies. They were the hairdressers and taxi drivers of their era! Yet, has this ancient tradition escaped our town council?

IMG_2780

“The way this all started, we all got around the table,” Iain added, “we were all saying this, and we were sort of being listened to. Then, all of a sudden, it was all closed doors, because the asset transfer had come up. They did this without any reference to anybody, and said we’ve done it for the best interest of the town. I have no doubt the vast majority who stand for the town council, do so with good intentions, they want to do the right thing for the town, but they don’t see the other option. The option is to get the town onboard with them, and if WC are causing the problem, we can help them change it.” Convinced they cannot do it alone, Iain expressed he doesn’t know why, but is certain it ends with Devizes losing out, “for not having effective representation at Wiltshire level.”

“We talked to the people of the town,” he told, “they said we need as much parking as possible. Would love it to be free, but actually, the fact it’s there is most important.” On the origins of the fiasco, to provide an event space, Iain could see no reason to remove those parking spaces. Wiltshire council were saying they wanted to charge £1,500 a day for the suspension of parking, despite it being free at the time. “But since the people stood up and said, ‘we don’t like this,’ WC came up with a better deal, Devizes Town Council will own the space, we operate the parking, but any day you want it for special events it will be free of charge. That’s fantastic, and now we have that, it supports things like the Full Tone Festival, which went brilliantly. That can now happen as much as possible, and if so, it happens more, and at the point there is something happening each weekend, that’s the point where we could say we do want to pedestrianize some of this space.”

signal.jpg

The only argument I’ve really seen positive light on regarding the issue is the environmental angle, but while Iain agreed, observed it’d only move the problem, and lobbying to provide the area with better equipped recharging points, and availability for next generation vehicles is better, but another issue.

Herein lies our task, and why the issue involves Devizine, as we aim to promote and encourage events in our town. So, I finish by asking Iain if he feels the issue is akin to our own little Brexit! “I feel there’s a lot of parallels there! Similar is that it’s a problem of their own devising. We don’t have to have any changes to the market place.” Personally, he is up for making the area look as nice as it can be, but expresses the costing of the changes, and concerns himself that the Town Council haven’t costed the alterations effectually.

“We never campaigned for free parking,” Iain said, “only for fair parking.” Waffling on about the cost to councils for providing free parking on business rates.” Whatever, all I know is if it’s 40p in the Sham, but 70p here, people will shop elsewhere, and how can this move possibly be in the best interest to the town?

greggs

The fight continues, I proposed to Iain if he feels it will get to the drastic stage of organising a protest. “I prefer to be collaborative, but it’s interesting to look at the fact the change came, the council doing a U-turn, came after a lot of the public attended the meetings. So, it may have to come to that, or a vote of no-confidence in the Council. I think it’s a last resort, but are we not getting to that last resort?”

I’ll let you decide, I’ve ironically near overstayed my parking limit, but thank Iain for his lengthy opinions on this pressing issue and the tour of his wonderful teddy bear shop!

Join The Devizes Future Market Place Facebook group for updates and information


© 2017-2019 Devizine (Darren Worrow)
Please seek permission from the Devizine site and any individual author, artist or photographer before using any content on this website. Unauthorised usage of any images or text is forbidden.


Adverts & That!

famewurzelnewinnshoesfestswbdbillgreengardenpartyflyingmonkbigyellowswindevizintstreetbronteman1000udelargy10pmixuppost65217389_1310844582401986_2449299795982942208_onewadvertad

REVIEW – Lark In The Park (Hillworth), Kimberley Rew @ The Southgate, Eddie Witcomb@ White Bear, Devizes

In The Wet And The Dry

Andy Fawthrop

Another busy Sunday afternoon of free music gigs around the town.

First to Hillworth Park for the much under-advertised “Lark In The Park”. I’ve heard of stealth marketing, but sometimes I think Fantasy Radio can take this too far. I saw/ heard very little about this, apart from one post on Facebook, so I wasn’t surprised to turn up an hour after the start of this event to find very few people there. Granted the weather forecast wasn’t great, but I suspect they’d get bigger audiences if they told a few more people what was going on. I managed to catch Clare doing a short set before the heavens opened in mid-afternoon then, like others, took refuge in the café for a coffee. Once it became obvious that the rain wasn’t going to stop any time soon, the few brave souls who’d turned up just melted away. I decided to join them. Bit of a wash-out.

sunday1

Fortunately the Southgate is just round the corner so I settled in there with a pint, and was soon joined by friends. The entertainment was provided by Kimberley Rew on guitar, and his wife & partner-in-crime Lee Cave-Berry on bass. Rew’s main claim to fame is having been guitarist and song-writer with Katrina & The Waves, having penned their big hit “Walking on Sunshine”, followed later in 1999 by “Love Shine A Light” when the band won the Eurovision Song Contest (remember that??). Since the band’s demise, Rew has produced a string of solo albums, and has clearly not lost the knack of writing catchy tunes.

The duo served up plenty of bop-along material, blending riffs from pop, boogie-woogie, rock and blues. There was some fine lead guitar from Rew, and solid vocals from both. If anything, it was a bit too exciting for a rainy Sunday afternoon, but absolutely nobody was complaining. It certainly blew out the cobwebs.

sunday2

By the end of their first set, the weather had started behaving itself again, and the sun made a belated appearance. So I made my way back down into town, and to the White Bear to catch Eddie Witcomb.

Eddie hails from up the road in Marlborough, and he’d pulled along his dad and a mate or two. So we had the start of a small, but beautifully-formed, audience which grew in size as the afternoon turned into early evening. Eddie did two sets, nicely blending his own very personal material with some carefully selected covers. We were treated to his versions of “Paranoid”, “Roxanne”, “Tears In Heaven” and “Stand By Me”, amongst others. His own songs were well-turned, featuring some fine playing, and delicate vocals. It was a mark of the quality of these songs, that they were as strongly received as the covers. His style was relaxed, and he was fully ready to engage in banter with the audience. He did confide that he was playing with a bit of a hangover, but if he was there was very little sign of it.

sunday3

So another great (free) Sunday of music around the town. I think we just shaded it – Weather 1, Music 2, and we all went home happy yet again.


© 2017-2019 Devizine (Andy Fawthrop)
Please seek permission from the Devizine site and any individual author, artist or photographer before using any content on this website. Unauthorised usage of any images or text is forbidden.


Adverts & All That!

billgreengardenpartydevizintstreetbronteman1000udelargyflyingmonknewadvertad10pmixuppost65217389_1310844582401986_2449299795982942208_ofemale2019vinylrealm

REVIEW – The Bone Chapel @ The Southgate, Devizes

No Bones About It!

Andy Fawthrop

Another little stroll up the hill on Saturday night to The Gate to see Swindon-based The Bone Chapel.

Drawn in by their billing as “cosmic Blues featuring broken guitars, shamanic percussion and whisky- soaked original songs of salvation, damnation, lost dreams, hope and love”, I had to admit I was intrigued to see if that was actually what they delivered. TBH it wasn’t. I’m not sure that any of that was ever actually on offer, just nicely-turned marketing bollocks. But on the positive side I did get to see and hear a rather excellent band.

The duo, consisting of guitar/ vocals and drums, got off to a gentle, laid-back start. It took a little while to get the crowd actually listening, rather than chatting, but once they got into their stride, things picked up quite a bit. There was nothing showy, nothing forced or strained, just some very competent blues and boogie-woogie. Folks started dancing and getting into the swing. We got some nice covers, including a great version of Joni Mitchell’s Big Yellow Taxi, which went down a storm. And, for a mere two-piece, they laid down some great sounds, and nicely-textured toons.

bonechap2

There were no broken guitars – but there was some great playing. There was no shamanic percussion – but there was good drumming. The crowd built, the crowd stayed, and the crowd liked what they heard. Can’t say fairer than that.

Another good gig – thanks Debs & Dave!

Future gigs at The Southgate (all FREE) are:

Friday 16th August: Broken Bones Matilda
Saturday 17th August: The Corsairs
Friday 23rd August: Beyond The Storm
Saturday 24th August: Sophia & The Soul Brothers
Sunday 25th August: Vince Bell
Friday 30th August: Daydream Runaways
Sunday 1st September: Gary Hall


© 2017-2019 Devizine (Andy Fawthrop)
Please seek permission from the Devizine site and any individual author, artist or photographer before using any content on this website. Unauthorised usage of any images or text is forbidden.


Adverts & All That!

gardenpartydevizintstreetudelman1000brontemayorsbabyargyvinylrealm10pmixuppost65217389_1310844582401986_2449299795982942208_ofemale2019newadvertad

REVIEW – George Wilding @ Cellar Bar, Bear Hotel, Devizes

Andy Fawthrop

Images by Gail Foster

George Goes Wild For Charity

 

We all have different approaches to raising money for charity. Some of us lie naked in a bath full of cold baked beans. Some of us shave off all our hair. And some of us choose to terrorise the local neighbourhood by driving a milk float dressed in a Spiderman onesie. [what kind of idiot would even contemplate that?! ED] Each to their own. But some people go for a more straight-forward approach and simply put on a musical benefit night (so as not to frighten the neighbours).

And so it was that Mirko Pangrazzi put on a concert to raise funds for specialist treatment for brain damage for his son Liam. And so it was that we all dutifully piled in to the Cellar Bar last night to support him. Of course The Cellar Bar as a venue would have been a pretty poor attraction in its own right, but thankfully there was the irrepressible George Wilding to light up the evening for us.

Gail_George1_08_08_19

You’ve got to admire George for his sheer versatility. Not only did he showcase some of his own (very good) material, but he belted out covers from right across the musical spectrum. I love the way he’s prepared to have a crack at almost anything, sometimes discovering half-way through a number that he can’t remember the rest of it. But it doesn’t matter. Every number is good fun anyway. I’ve recently started to think of him as a sort of human juke-box, such is his range. And he delivers it all with enormous energy and great good humour.

To be honest – he was playing to a good roomful of friends and fans, but I don’t think it would have made the slightest difference – the boy would’ve been super-good whatever the circumstances.

Gail_George3_08_08_19

But amid all the great music, the wonderful atmosphere, and the cracking-good entertainment, it would have been easy to forget why we were all there. Turns out that financially it was a great success, with over £300 raised for Liam. So the crowd were not only enthusiastic, but also very generous.

It was good to see Mirko back at the helm in the Cellar Bar again, good to see George on absolute top form, and great to see a good crowd enjoying themselves. Great night.

Gail_George4_08_08_19


© 2017-2019 Devizine (Andy Fawthrop/Gail Foster)
Please seek permission from the Devizine site and any individual author, artist or photographer before using any content on this website. Unauthorised usage of any images or text is forbidden.


 

Adverts & All That!

viccancermarlrisegardenpartyargydevizintstreetbronteman1000udel10pmixuppostnewadvertad65217389_1310844582401986_2449299795982942208_ofemale2019vinylrealm

REVIEW –Rockin’ Bandits @ Hillworth, Jamie Williams @ Southgate, and Ian O’Regan @ The White Bear, Devizes – Sunday 28th July 2019

Another Free & Easy Sunday Afternoon in The Vize

 

Andy Fawthrop

This is getting to be a habit now. It’s a Sunday, the weather is balmy, and there’s lots of free music on offer.

Firstly to Hillworth Park for Fantasy Radio’s final Month of Sundays, featuring a live on-air radio show, showcasing the talents of a local artists. Today it was the turn of the Rockin’ Bandits, who delivered their usual performance of swing, country and rockabilly. Mixing a few of their own numbers with plenty of covers – Buddy Holly, Carl Perkins, Johnny Horton, Jerry Lee Lewis, Johnny Cash – you name it – the crowd really lapped it all up. Perfect nostalgia music for a sunny afternoon in the park.

rockin

I couldn’t stay quite to the end because I wanted to get along to The Southgate to catch Jamie Williams & The Roots Collective – a five-piece band who really dress the part. This Essex-based outfit knocked out an altogether more get-down-and-boogie kind of sound, with a blues and Americana edge to their original material. Their set also took a tour around some nice country-rock licks. It was a good atmosphere, with all the windows thrown open, the crowd listening both inside and outside of the pub.

collective

And finally, back down into town to listen to Ian O’Regan at the White Bear. Ian doesn’t really do his own material – he’s not yer usual singer/ songwriter – but what he lacks in the song-writing department he more than makes up for in the quality, range and sheer versatility of his singing and guitar-playing. His skill lies in the interpretation and delivery of other people’s great songs. His repertoire is eclectic, covering blues, folk, “Irish & Western”, country and rock. Occasionally sipping at his water, he established his usual friendly bantering rapport with the audience. And he played his heart out to a very appreciative audience – for two hours solid without a break! And even after that he had enough energy left to play an encore. Amazing stamina and dedication!

oreagan

Yet another great afternoon – three gigs in five hours – and all of it free!

So keep your eyes peeled over the next few weeks, both before and after the Devizes International Street Festival there’s loads more (free) music scheduled in Hillworth Park, The Southgate, The Three Crowns, The White Bear and other venues too.


© 2017-2019 Devizine (Andy Fawthrop)
Please seek permission from the Devizine site and any individual author, artist or photographer before using any content on this website. Unauthorised usage of any images or text is forbidden.


Adverts & All That!

spidermilkmanphoto

wildingcellaefemale2019newadvertadvinylrealm

Things to do with your Little Darlings during the Summer Hols!

Have I even got time between running around the house shouting “Pikachu,” and polishing my Minecraft skills to draft this article in time? Yep, take a gulp of wine parents, it’s school summer holidays, again. Take another gulp, it’s forecast to be hot and bothering, heck, give them the whole flipping bottle!

Ease up though, Devizine has bought you a guide of local things to do, which won’t strain your purse too much.

If you send me details of an event or activity I have missed, I can edit this; let’s make a comprehensive guide to everything going on for kids and parents, before they complain they’re bored……the parents that is!


Friday 26th July:

Legally Blonde @ The Wharf Theatre, Devizes

legallyblondehead


Mini Fair @ The Rowdey Cow, Devizes

The mini fair is coming to the Rowdey Cow to celebrate the start of the summer holidays- with inflatables, roundabout, hook a duck and football fun and they will be staying with us for a couple of weeks!


End of term disco @ The Cavalier Community Hall, Devizes

5pm – 7:30pm. Admission is FREE, just turn up.

fredico.jpg


Saturday July 27th:

Steampunk Workshop @ Wiltshire Scrapstore & Resource Centre

Get creative, take up the gauntlet and sign up for this Steampunk Challenge Workshop! Steampunk inspired refreshments provided. During the workshop, you’ll be making hats, masks and accessories. Bring your own items to upcycle, or let your imagination go wild and make something from scratch; all using our resources! They will provide all resources required.


Bowood’s Summer Garden Party

https://www.bowood.org/whatson/


Sunday 28th July:

Family Fun Day @ Fortune Inn Pub & Chinese Restaurant

https://www.facebook.com/events/295861581331046/


Monday 29th July:

Young Melksham

young melksham.jpg

Young Melksham’s Summer Holiday Activity afternoons kick off on Monday! So why not come down and join in the fun?! 2pm till 5pm Monday to Friday just £2.50 per session!! For all young people going into year 5 and up! https://www.youngmelksham.org.uk/


popupcafe


Monday 29th July – Friday 2nd August:

MUSICAL IN A WEEK! @ Wiltshire Music Centre, Bradford on Avon

Whether you were born to be on stage or this is your first step into the limelight, join Felicity Courage for a fantastic five days – jam packed with singing, acting, and dancing – creating a brand-new show-stopping mystery musical. 5 – 14 yrs: £120 child / £110 sibling (five days) Dress for movement / Bring a packed lunch.


papersmiles


This Summer @ Fired Thoughts. Clay Fun Fridays & Ad hoc Saturdays! Call or email, or book online to come and make in clay. Simple projects to get you started or do your own thing. General studio sessions £10 per person per session. Wheel sessions: £22.50 per half hour with 1:1 tuition.


Tuesday 30th July:

Shires Craft, Trowbridge

Pop along to the Shires for fantastic, free crafts. Drop-in 10.30 – 12.30 and 1.30 – 3.30. Ages 4+.

shires.png


Wessex Water(y) Workshop @ Wiltshire Scrapstore & Resource Centre

Wessex Water provide water to your taps at home and at school. Gillian Smith, Education Adviser will be there to help you create some wonderful watery creations! Please bring your ideas and imagination! Perhaps you would like to make a friendly, fishy mobile to hang in your bedroom? Could you invent a new sea creature? Can you make a diorama to show where the sea creature would live?


Wednesday 31st July:

Free Children’s Boot Camp @ Rowde Playing Field

boot

Ages 5-16. Reserve your place: rpc.lisayouth@gmail.com


Thursday 1st August:

Kids Summer Sewing for 8-11-year olds @ Franklins, Salisbury.


Friday 2nd August:

Ali Baba & the Forty Thieves!’ outdoor family theatre @ Lacock Abbey


Saturday 3rd August:

Splash Park Grand Opening @ King George Playing Field, Melksham

Free to attend, its beach themed without the sand! Fish & chips, ice cream, deck chairs and water play.. fun for all the family.

splash


Summer of Fun @ Borough Parade, Chippenham.

Starting Saturday 3rd August and for the following 2 Saturdays at Borough Parade they can enjoy themed family fun for Free from 11am. Why not give our balloon modellers a challenge, have your face painted with your fave character or join in with some of the circus skills on show.


Monday 5th August:

FIDGETY FEET DANCE AND DRAMA @ Wiltshire Music Centre, Bradford on Avon

9.30AM – 10.20AM / 10.30AM – 11.20AM Join Fidgety Feet for a Pirate and Mermaid themed interactive dance, drama and storytelling workshop. Using props, music and lots of imagination come with us on an exciting journey on and in the high seas. Perfect for little performers! 18 mo – 5 yrs: £7 child / £2 adult. Supervision required, babes in arms attend for free.


Monday 5th – Tuesday 6th August:

NEON DANCE @ Wiltshire Music Centre, Bradford on Avon

10AM – 3PM. Join internationally renowned choreographer Adrienne Hart for a two-day contemporary dance course. Morning technique class will be followed by choreography and rehearsal as participants work towards a final showcase. This is a friendly and inclusive course for young dancers to improve their skills. 13 – 18 yrs: £50. Open to all abilities. Dress for movement / Bring a packed lunch.


Tuesday 6th August:

A Treasure at Sea for Dragon & Me at Chippenham Library

Dorset & Wilts Fire & Rescue Service story session. Water safety for kids (and dragons!). FREE interactive story time suitable for 4-7-year olds. There will be fun activities and dressing up too! Booking recommended.
https://www.facebook.com/events/856298231403596/


SONGWRITING FOR IMPROVERS @ Wiltshire Music Centre, Bradford on Avon

Develop your skills and take your song writing to the next level with songwriter, performer and artist Louise Jordan. 13 – 18 yrs: £15 All instruments welcome but not required


SONGWRITING FOR BEGINNERS @ Wiltshire Music Centre, Bradford on Avon

Learn how to write songs and bring your ideas to life with songwriter, performer and artist Louise Jordan. 13 – 18 yrs: £15. Open to all abilities, all instruments welcome but not required.


Tuesday 6th August- Wednesday 7th August:

Dinosaurs and Fossils @ Wiltshire Museum

Art and craft activities for under 11s. There is a different theme each week: Activities to include creating miniature dinosaur lands. Two sessions per day: 11am to 12.30pm and 1.30pm to 3pm. Booking essential as there are limited places. £5 per child. Under 8s to be accompanied by an adult please.

museum3fi


Wednesday 7th August:

Free Children’s Boot Camp @ Rowde Playing Field

Ages 5-16. Reserve your place: rpc.lisayouth@gmail.com


Willy Wonka – Wonderful Wednesday Workshop @ Wiltshire Scrapstore & Resource Centre, Bowden Hill.

They’ve got the perfect crafting workshop for you… Willy Wonka inspired Workshop with super Sara, sweets & decorations are the order of the day. Light refreshments served during the workshop.


ANIMATION WORKSHOP @ Wiltshire Music Centre, Bradford on Avon

Create your own stop-frame animation during this fun workshop with film producer and photographer Jamie McDine. You will learn professional film making skills with lots of hands on activities and working within teams you will plan and produce your own stop-motion film! 9 – 14 yrs: £25. Open to all. Bring a packed lunch.


Thursday 8th August:

BEAUTIFUL BUGS & BUTTERFLIES @ Wiltshire Music Centre, Bradford on Avon

10AM – 11.30AM Join Chrissie to explore the magical world of creepy crawlies and butterflies through songs, creative art, messy play and a special interactive story. Activities will include making a caterpillar sock puppet, a peg butterfly and junk modelling. 2 – 4 yrs: £7 child / £2 adult. Supervision required, babes in arms attend for free. Dress for mess!


BIRDS IN FLIGHT @ Wiltshire Music Centre, Bradford on Avon

Flap your wings and get ready to fly. Come along and make a unique bird mask and wings. Will you choose to be a tame garden bird, an exotic parrot or a soaring eagle? 5 – 7 yrs: £7 child / £2 adult. Supervision welcome but not required. Dress for mess.


Friday 9th August:

SOMEWHERE OVER THE RAINBOW@ Wiltshire Music Centre, Bradford on Avon

10AM – 11.30AM Join Chrissie on a very messy rainbow journey, explore colour in a variety of ways, using hands and feet, paint and playdough. Sing your way through the morning as you make colourful art to take home. 2 – 4 yrs: £7 child / £2 adult. Supervision required, babes in arms attend for free. Dress for mess!


FLAGS AND BUNTING @ Wiltshire Music Centre, Bradford on Avon

1PM – 3PM. Join Chrissie to make a string of bunting for your bedroom and a rainbow flag for your garden. We will experiment with wax, pens and paints to create special works of art. 5 – 7 yrs: £7 child / £2 adult. Supervision welcome but not required. Dress for mess.


Saturday 10th August:

Seend Village Fete

Undoubtedly one of the best villages fetes for miles; good family fun!


Summer of Fun @ Borough Parade, Chippenham

Starting Saturday 3rd August and for the following 2 Saturdays at Borough Parade they can enjoy themed family fun for Free from 11am. Why not give our balloon modellers a challenge, have your face painted with your fave character or join in with some of the circus skills on show.


Saturday 10th – 11th August:

Frome Comic Con

https://www.fromecomiccon.com/


Sunday 11th August:

Lark in the Park with Fantasy Radio @ Hillworth Park, Devizes


Monday 12th August:

charlotte.jpg

A THOUSAND TWANGLING INSTRUMENTS @ Wiltshire Music Centre, Bradford on Avon

Calling all budding musicians, composers, actors and songwriters! Over the course of 3 days, we will put on a Shakespeare play, complete with songs and music written during the course. Work with two experienced professionals to create a unique performance with sound and music. 12 – 21 yrs: £85 Bring a packed lunch.


Monday 12th – Wednesday 14th August:

Create a play in a week! Summer Schools for ages 4-10 @ The Shoebox Theatre, Swindon

shoebox.jpg

Our drama summer schools are designed to support your child in their creative development. We introduce children to interesting stories, characters and text in an imaginative and fun way. As well as developing their performance skills, students will learn to work with others, build confidence and improve their communication skills.

At the start of the week our two groups (ages 4-6 and ages 7-10) will choose a classic children’s story to bring to life and will then spend the week creating their very own version including the performance, masks and props!

On the final day, we’ll invite friends and family to come and see the final show! Expect a week of learning, friend making, creativity and fun!

All our Teachers are Drama School or University educated and undergo enhanced DBS checks.

When: Monday 12th – Friday 16th of August, 9am-3pm
Cost: £125: https://www.shoeboxtheatre.org.uk/summerschool


DEVISING DRAMA @ Wiltshire Music Centre, Bradford on Avon

10AM – 3PM Join Beth for an imaginative three days, devising from a variety of different stimuli, developing drama skills, making new friends and creating your very own show. Join us for a brilliant, busy three days of fun! 6 – 11 yrs, £60. Dress for movement / Bring a packed lunch


Tuesday 13th August:

August Children’s Holiday Clubs @ The Farm Cookery School, Netherstreet

We run Children’s holiday clubs throughout August for ages: 5+, 7-9, 8+ & 11+. Every week is a different cooking theme with Mexican, British & Greek food. These are great classes for kids to learn new skills and have lots of fun. Please see our website for more details: https://thefarmcookeryschool.co.uk/childrens-holiday-clubs/


JUNGLE FEVER – SQUAWK, RATTLE AND ROAR@ Wiltshire Music Centre, Bradford on Avon

10AM – 1.30PM Come and spend a morning making a range of simple instruments with Dave King to create your own Jungle Orchestra to play and take home! Learn how sound is produced using everyday materials and discover the amazing properties of bamboo, the world’s most sustainable plant. 8 – 13 yrs, £18


southwick


Wednesday 13th and Thursday 14th August:

Ancient Greek Mythology @ Wiltshire Museum

Activities to include golden head dresses and painting terracotta dishes with mythological designs. Two sessions per day: 11am to 12.30pm and 1.30pm to 3pm. Booking essential as there are limited places. £5 per child. Under 8s to be accompanied by an adult please.


Thursday 15th August:

A Musical Zoo! @ Marden House, Calne or Trowbridge Town Hall

Music for Miniatures host concerts for kids, Join them for a musical journey to the zoo and more, with music from oboe, cor anglais, clarinet, bass clarinet and piano. Bring your cuddly animals along too, or dress up as an animal! A lively morning of amazing live classical music for you and your little one. Tickets available online or on the door.


Friday 16th August:

LITTLE PICCOLOS@ Wiltshire Music Centre, Bradford on Avon

9.30AM – 10.20AM. Music Classes specifically designed to make music accessible for younger children. Each session is full of singing, playing instruments, and are entirely acoustic. 1 – 6 yrs: £7 child / £2 adult. Supervision required, babes in arms attend for free.


THE YOGA PATCH@ Wiltshire Music Centre, Bradford on Avon

10.30AM – 11.20AM Yoga comes to life in these fun and creative classes designed to stimulate younger children’s growing curiosity. We use playful yoga poses, animated breathing exercises and imaginative relaxation techniques, to help enhance language development, motor coordination and play skills. 2 – 6 yrs: £7 child / £2 adult. Supervision required, babes in arms attend for free.


Saturday 17th August:

Pirate Family Fun Day @ The Borough Parade & Chippenham Museum

If you’ve a little scallywag then make sure you bring them along on Saturday 17th August for some Pirate themed fun at Borough Parade. The fabulous Clare’s Circus are back with their incredible face painting creations, balloon modelling madness and unbelievable interactive circus skills. The lovely staff at Waterstones have confirmed they’ll also be running storytelling and activities that day to add to the holiday fun. Will you find the treasure or will you be made to walk the plank?
All the activities happening at Borough Parade are FREE and are funded by the generosity of our stores as part of our community engagement scheme.
There will also be lots more swashbuckling activities happening throughout the town thanks to Chippenham Town Council.

Pirate Family Fun Day


Warminster Medieval Fair

This free entry event will bring the medieval times to the historical town of Warminster with knightly combat, living history and historical education. There will also be live acoustic music contemporary to the era, storytelling and falconry as well as a folk market. Living history tents will demonstrate skills and replica items to immerse you into the medieval mindset and lifestyle. https://www.facebook.com/events/309398803255677/


The Hall Family Day, Bradford on Avon

https://www.eventbrite.co.uk/e/the-hall-family-day-tickets-64958988082


Glow in the Park: Longleat

https://www.longleat.co.uk/whats-on/glow-in-the-park


Saturday 17th & Sunday 18th August:

Outdoor Adventure Weekend- Climbing Wall @ Whitehall Garden Centre, Lacock

A selection of activities including archery, axe throwing and an 8-metre climbing wall. Experienced instructors are on hand at each event to assist you and all equipment is provided.


Sunday 18th August:

Picnic in the Park @ Hilworth, Devizes


Trowbridge Soapbox Derby

https://www.facebook.com/events/2457145290997609/


Miss Squire at Home @ Sevington Victorian School, Chippenham

http://www.sevingtonvictorianschool.co.uk
Wiltshire’s best kept secret. Homemade afternoon tea, children’s activities and free tours of the school. Admission per head: Adults £2 , Children £1 Family ticket £5


Monday 19th August:

The Fulltone Music School: Summer Holidays Musical Theatre Workshop, Potterne

A fantastic 4-day course on musical theatre for age 11 and up. Learning stagecraft, singing techniques, singing in harmony and singing a selection of fantastic musical theatre songs culminating in a SHOWCASE on the Thursday evening at 5pm! It will be a FANTASTIC few days! £100 email jemmaroberts@hotmail.com to book!


SINGING DAY WITH KATE COURAGE @ Wiltshire Music Centre, Bradford on Avon

10AM – 3PM Come and sing for a whole day! Learn new songs, make new friends and develop your voice and singing techniques. We will perform a concert at the end of the day of everything we have learned. We will try out new warm-ups, work on performance skills and sing in harmony. 8 – 14 yrs, £25. Open to all abilities. Bring a packed lunch.


Tuesday 20th August:

August Children’s Holiday Clubs @ The Farm Cookery School, Netherstreet

We run Children’s holiday clubs throughout August for ages: 5+, 7-9, 8+ & 11+. Every week is a different cooking theme with Mexican, British & Greek food. These are great classes for kids to learn new skills and have lots of fun. Please see our website for more details: https://thefarmcookeryschool.co.uk/childrens-holiday-clubs/


MYTHICAL STORIES WITH MICHAEL LOADER@ Wiltshire Music Centre, Bradford on Avon

10AM – 3PM Join Michael Loader for an exciting workshop where you will hear and tell stories, play drama games, create theatre and make music. Bring your ideas, enthusiasm and imagination to put into your own creative performance! 7 – 11 yrs, £20. Costumes and instruments provided but you are welcome to bring your own. Bring a packed lunch.


Dinosaur Roar! Story and craft session @ Chippenham Library

Suitable for ages 4-7. Tickets £1.50 for library members and £2 for non-members. Please book at the library desk.


Tuesday 20th & Wednesday 21st August:

Summer Textiles and Craft @ Wiltshire Museum

Activities to include painting fabric bags with summer designs and mini sun and flower design rag rugs. Two sessions per day: 11am to 12.30pm and 1.30pm to 3pm. Booking essential as there are limited places. £5 per child. Under 8s to be accompanied by an adult please.


Wednesday 21st August:

Let’s Go Fly a Kite Wonder Wednesday Workshop @ Wiltshire Scrapstore & Resource Centre

Do you want to experience a truly Supercalifragilisticexpialidocious workshop? Then come and join this Mary Poppins inspired workshop, and make your own kite from all our lovely Scrapstore resources. Light refreshments served during the workshop.


ROCK THE TOTS – SUMMER PARTY! @ Wiltshire Music Centre, Bradford on Avon

Gigs for little people… and their grown-ups! With music, puppets, percussion and stories, you and your little one will have a blast. After lots of fun music events across Wiltshire in 2019, this is Rock The Tot’s big summer gig, where all our songs will have a summer theme! 0 – 5 yrs, £7 child / £3 adult. Babes in arms attend for free.


August Children’s Holiday Clubs @ The Farm Cookery School, Netherstreet.

We run Children’s holiday clubs throughout August for ages: 5+, 7-9, 8+ & 11+. Every week is a different cooking theme with Mexican, British & Greek food. These are great classes for kids to learn new skills and have lots of fun. Please see our website for more details: https://thefarmcookeryschool.co.uk/childrens-holiday-clubs/


Thursday 22nd -Friday 23rd August:

REVINYL SESSIONS@ Wiltshire Music Centre, Bradford on Avon

10AM-3PM Calling all secret bedroom DJs! Hit the decks and learn from industry professionals in this two-day session perfect for beginners. Revinyl Sessions are here to share their love of music and DJing. 13 – 19 yrs, £50.


Sunday 25th August:

Devizes International Street Festival, The Green


Stompers Juniors: Juniors in The Jungle! @ Venom nightclub, Westbury

A Magical rave experience for the whole family in a safe, fun & friendly environment. With DJs Dougal, Miss Special K, Andy Demize, Slic and MCs 3man & Restless.


Children’s Treasure Hunt @ Swindon & Cricklade Railway

An easy day for the kids- spot 30 little engines around the railway and win a prize. https://www.facebook.com/events/1905855732797531/


Monday 26th August:
Devizes International Street Festival, The Market Place


Tuesday 27th August:

August Children’s Holiday Clubs @ The Farm Cookery School, Netherstreet.

We run Children’s holiday clubs throughout August for ages: 5+, 7-9, 8+ & 11+. Every week is a different cooking theme with Mexican, British & Greek food. These are great classes for kids to learn new skills and have lots of fun. Please see our website for more details: https://thefarmcookeryschool.co.uk/childrens-holiday-clubs/


Thursday 29th August:

Salisbury Forest School Holiday Club: for children aged 7-11

Forest School holiday club includes nature-themed activity sessions run by Wiltshire Wildlife Trust staff. Activities include: Bird watching- Woodworking- Nature discovery trail- Pond dipping. Cost: £20 per child. Drop off: 8:30amPick up: 5:30pm Children will need to bring a packed lunch/snacks for the day. Please make sure your child comes with the appropriate clothing for outdoor activities. Upon completion of booking an email will be sent to you with Parental Consent form, which must be completed prior to final confirmation. This reserve can be hard to find, so please look at directions before travelling and leave with plenty of time. More information on the reserve and directions can be found here. To book, please contact events@wiltshirewildlife.org or 01380 829070 or book online.


Friday 30th August:

First Aid Training for Children @ Marlborough Rugby Club

Do you want your children to have the confidence to step forward and save a life?

Then book them onto one of my first aid courses on Friday 30th August at Marlborough rugby club. These sessions are fun and practical and teaches them how to save your life, while you enjoy a well earned break in the shops and cafes of Marlborough, or catch up on some admin!

🔹️5-9 year olds at 1030am-12 noon – £18 (£15 for siblings)
🔹️10-14 year olds at 1230-230pm – £24 (£20 for siblings)

Price includes certificate, handout and refreshments.

Details and online booking at https://www.facebook.com/events/440730396483621/


Saturday August 31st:
Devizes Confetti Battle

Little introduction needed for this one, but The Confetti Battle takes place at the finish line of the new Colour Rush 5km route, so expect to see some exceptionally colourful visitors in the crowd.

Confetti-Battle-featured-image

Last year saw the introduction of a token system where you can buy tokens to exchange for the confetti before the event, they’ll use the same system again this year. The token stand will be outside the Corn Exchange. Swap your tokens for confetti at the tables near to the front of Times Square. Keep your eyes peeled when collecting your confetti as one lucky person will receive a Golden Ticket in a confetti bag, info about the prize will be announced soon.

Jennings fairground will be in the Market Place on until 11.00pm


Melksham Food and River Festival 2019

The Melksham Food and River Festival is organised by the Festival Committee with support from the Melksham, Calne & Chippenham Branch of the Wilts & Berks Canal Trust and the Wiltshire Youth Canoe Club. The Festival seeks to provide a platform for local food and drink producers, community groups, local entrepreneurs and start-up businesses.
Come and visit us during the weekend 31st August – 1st September 2019 entry is FREE and after browsing the stalls and indulging in some retail therapy, you can relax and enjoy al-fresco locally produced food and drink, whilst listening to the live music and watching the boats on the river.


Sunday September 8th:

Children’s Proms in the Park @ Hillworth Park, Devizes

This is a free, family friendly event supported by Devizes Town Council. 2pm-4pm.
Singalong with Devizes Town Band at their annual hugely successful Children’s Proms event as they delight with film and TV themes from past and present; dressing up essential!

boredkid


Various Dates Throughout the Holiday!

kickers


Wiltshire Council’s Camp Active

d18236ld-camp-activate-social-media-ad-final.jpg


Summer Fun Activities @ The Neeld, Chippenham

This summer, the Neeld Community and Arts Centre will be offering fun circus skills sessions with Clare’s Circus!
There will be lots of exciting activities for children, and parents will be very welcome to join in with the fun and games! Clare’s Circus can teach you to juggle, you can learn tricks with spinning plates and diabolo and there will be stilt walking and pedal go’s, as well as soft play for the little ones and a tightwire for thrill seekers.
In addition, there will be a great craft making table and the chance to make balloon animals with Mr Twister, the best balloon twister this side of the River Avon! Child (Under 16) £5 Free entry for accompanying adults: http://www.neeld.co.uk/whats-on/summer-fun-activities.


Active Trowbridge @ King George Playing Fields, Melksham

Each Wednesday Active Trowbridge will be in the park with activities, sports and bouncy castles!


Jurassic Farm @ Roves Farm, Swindon

Fire up your imagination on a Roves Farm tractor ride this summer. We’ve got three fun and interactive themed events that the whole family will enjoy, including our Jurassic Farm safari!
Join the Roves Farm ranger as we take a tractor safari through our very own dinosaur territories. We’ll be trying to detect and even discover a brand-new species of dinosaur as we go… What will we find?
Meanwhile back at the farm there’s a whole day of hands-on farm activities to keep you busy including; egg collecting, meet the animals, feed the goats, animal racing and lots more!

https://rovesfarm.co.uk/whats-on/


Family Fun Coaching @ Sleight Valley Golf Range

Family coaching with our Golf Coach is free but you will need to purchase the range balls you use; these start at £4.75 for 50 balls. club hire is free. There is no need to book just turn up.
Our Homefield Cafe will be open so pop in for something to eat and drink while you are here. For more details call 01380 729053. THURS 1st 10:00 – 12:00, FRI 9th 10:00 – 12:00, WED 14th 10:00 – 12:00, WED 21st 10:00 – 12:00, WED 28th.


Wiltshire Scrapstore & Resource Centre: Holiday Art Club

Scrap Modelling at its finest! Bring your mini-Monet’s along to these popular Holiday Art Clubs, and teach them the importance of reducing and reusing our waste; all whilst having lots of fun using the scrap resources! Each session is run by a qualified trainer. Find out more about them here: https://www.wiltshirescrapstore.org.uk/press-media/?v=79cba1185463


Australian Summer @ Longleat, Warminster

20th July – 2nd September
https://www.longleat.co.uk/whats-on/an-australian-summer


Devizes Marina

Looking for something to do over the school holidays that’s a bit different? Why not take our day boat out for the day? Up to 8 people (and a dog) can be aboard for a day exploring the Kennet & Avon Canal. Find out more at http://www.devizesmarina.com


Trowbridge Museum

Has a number of events, activities and workshops taking place over the summer holidays. This summer they take the “Museum on The Move” as they decamp to the Shires for a crafty day, spend a couple of days in the Sensory Garden on their Archaeological Dig, visit Salisbury’s Rifles Museum for some WW2 activities and put on a Summer School of craft demonstrations, local history and more at Trowbridge Town Hall.
Saturday 27th & Sunday 28th July, 11am – 3pm: Archaeological Dig in the Sensory Garden
If you’ve ever wondered what lies underneath the Sensory Garden, now is the chance to find out because we are going to dig several large holes to find out. Come along to our archaeological dig and see what treasures we unearth! Suitable for all the family.

WW2 at the Rifles Museum, Salisbury
Come and join us for three days of WW2-themed activities in the beautiful gardens of the Rifles Museum. There’ll be challenges, crafts and dressing up, with something different each day. You can drop in between 11am and 3pm.
Wed 7th August: Rifles
Wed 14th August: Rifles
Wed 21st August: Rifles
Fri 9th August, 2pm: Strange Stroll (Family History Guided Walk)
Discover the weird world of the woollen trade; £2 per person, Ages 7+, children under 8 must be accompanied by an adult. Walks starts outside Mastershoe.


Town Hall Summer School, Trowbrigde

Trowbridge Museum are working with Town Hall Arts to bring you a summer of art, craft, history, fun and (war) games. Together with our volunteers we’ll be demonstrating a diverse range of art and crafts, putting on some challenging Mouse Hunts, sharing the secrets of Napoleonic war gaming and revealing some snippets of the town’s history. These drop-in activities are free but a donation would be really appreciated – give a little or a lot – it’s up to you!
Mon 29th July, 11am – 3pm: Stick weaving
Wed 31st July, 11am – 3pm: Printmaking
Thu 1st Aug, 11am – 3pm: Felting
Fri 2nd August, 11am – 3pm: Printmaking
Mon 5th Aug, 11am – 3pm: Mouse Hunt
Tue 6th Aug, 11am – 3pm: Willow Weaving
Fri 9th August, 11am – 3pm: War Gaming Demonstration
Mon 12th August, 11am – 3pm: Crochet
Wed 14th August, 10am – 12pm: Weaving
Mon 19th August, 11am – 3pm: Mouse Hunt
Tue 20th Aug, 11am – 3pm: Willow Weaving
Wed 21st August, 11am – 3pm: Trowbridge Postcards & Photos
Wed 28th August, 11am – 3pm: Trowbridge Postcards & Photos
Thu 29th Aug, 11am – 3pm: Willow Weaving
Fri 30th August, 11am – 3pm: Felting


boredkidknati
skaapplespidermilkmanphotowildingcellae61761376_2317738228282983_4698340355173515264_onewadvertadsilverfcvinylrealmshambles65217389_1310844582401986_2449299795982942208_o

 

REVIEW –Tamsin Quin/ Andrew Hurst @ Hillworth and Andy Juan @ The White Bear, Devizes – Sunday 21st July 2019

Laid-back musical Sunday afternoon in The Vize

Andy Fawthrop

 

Yet again it’s a Sunday, the weather is balmy, and the hangover is starting to recede a little. There seems to be a recurring theme here. Whatever.

After last night’s stunning free show in the Market Place, delivered by The Fulltone Orchestra, today was a day when there was a need to get very much chilled out and calmed down. I mean – singing along to Queen’s greatest hits, and dancing along to the Ibiza set are all very well, to say nothing of the odd jar of liquid refreshment – but since the crowds had all dispersed into the night a few hours previously, something a little more relaxed was very much required.

But not to worry. As ever, our little town, punched above its weight yet again and delivered just what was required.

Firstly to Hillworth Park for Fantasy Radio’s Month of Sundays, featuring a live on-air radio show, showcasing the talents of a couple of local artists. This was the third Sunday show for July (last one is next week 28th July), and it was the turn of Tamsin Quin and Andrew Hurst.

Tamsin’s two short sets included songs from her album Gypsy Blood. Her gentle, simple songs rang out across the park, and behind each one was a personal story, a thought, a feeling. Her delivery was both clear and heart-warming, and she (as always) established a friendly rapport with her audience. Perfect.

pk2.JPG

Andrew Hurst is also no stranger to the park, having played here for Fantasy last year too. Only last week I enjoyed Andrew’s longer session in the White Bear, but today it was a couple of shorter sets. He played both covers and self-penned numbers, ranging from the quiet and intimate, through to the noisier upbeat numbers. I was left wondering how two hands can play quite so many notes so quickly. Close your eyes sometimes and it sounded like two guitars – fantastic stuff.

Next week, the final one of the Month of Sundays, will feature the very entertaining Rockin’ Bandits. So get yourself along there!

I left the crowd enjoying their Sunday afternoon in the park because a) I wanted to check out another artist playing in the White Bear’s Sunday afternoon sessions, and b) it was time for a beer! The artist in question was Bristol-based Andy Juan – new to me, but glad I made the trip.

Andy is a singer/ songwriter of some considerable talent. His songs were well-crafted, his vocals intense, and his guitar-playing spot on. He’s one of those artists who, when he’s playing a song, gets completely in the zone, completely in the moment. His focus, his concentration, were wonderful to behold. Playing mostly his own beautiful songs, he wasn’t afraid to throw in the occasional cover as well. But this wasn’t done as a mere afterthought. I’ve long been of the opinion that, if you’re going to cover a well-known song, you need to do one of two things – either replicate the original very exactly (to show how well you can actually listen to another artist’s work), or else give the original a complete re-working (to show how you can re-interpret the meaning, or the feeling, of the original song, to add something entirely new). Andy was definitely in the latter category, and the results were truly stunning. I shall definitely be listening to this guy again.

prk1

On top of all that he delivered his sets with warmth and humour, engaging the audience throughout. And he was a nice bloke too.

Next Sunday (28th July) the White Bear’s Sunday session at 5pm will feature the very talented, and very versatile, Ian O’Regan. One not to be missed.

So there you go – one afternoon, three acoustic artists. Three different styles, but all united in being very talented, very entertaining and (thankfully) very laid-back – perfect! What’s not to like?


© 2017-2019 Devizine (Andy Fawthrop)
Please seek permission from the Devizine site and any individual author, artist or photographer before using any content on this website. Unauthorised usage of any images or text is forbidden.


 

Adverts & All That!

spidermilkmanphotoknatiwildingcellaeurbanbargesilverfcnewadvertadvinylrealm65217389_1310844582401986_2449299795982942208_ofemale2019

How Does Devizes Confetti Battle Compare to the World’s Most Bizarre Festivals?

Perhaps the most interesting part of our chat with DOCA coordinator, Loz, and definitely, the most controversial was the carnival’s date change. Still social media comments groan that Confetti Battle was traditionally on a Wednesday. Yet, bringing it to a Saturday makes it feasible for higher attendance, particularly tourists and day trippers.

Loz expressed it could be as renowned as the Cooper’s Hill Cheese Roll, and intends to diversify and extend the concept to interest a wider audience. In Devizes we take it for granted people annually gather in the Market Place to fling confetti at each other, without contemplating how bizarre this notion is to outsiders. Bizarre attracts adventurous visitors, hunting for something different; they’d come, they’d spend money, but less likely on a Wednesday evening.

rainforeest.jpg

This morning I read a blog about The Rainforest World Music Festival, three days partying in the rainforest near Kuching, Sarawak in Malaysia. Okay, the English was poorly translated, but the photos wowed. Given I’ve jested the word “festival” these-days seems to be a new-fangled soundbite whereby anyone can pop up a gazebo, hire a man with a guitar, sell some tinnies and allow gatherers to piss on his rhododendrons, and dub it a festival, it got me thinking exactly what constitutes a festival, internationally, how bizarre do some get, and how does our Confetti Battle compare?

coopershill

Investigation exposed some pretty outlandish and curious events, and some complete bonkers. Many you’d need to pack a suitcase for a lengthy flight for, others it seems are not so far away. The Coopers Hill Cheese Roll in Gloucestershire cropped up more times than injuries undoubtedly caused there, but nowhere have I discovered mention of Pewsey’s locally eminent Wheelbeerow Race, or Devizes and the weird custom of lobbing confetti at each other. Think outside the box, or Brittox, it is a tad weird, guys; but both on weeknights.

moose

Do they compare in weirdness to a moose dropping festival? Talkeetna, Alaska, it’s not snow falling from the sky, but moose poo, painted white and dropped from a helicopter! Or the International Hair-Freezing Contest in Yukon, Canada, where, as the name hints, using only water and the frosty air, contestants freeze their Barnett Fair into the most peculiar and eccentric shapes?

hair
Go under, check my pubes

While some are just ascetically bizarre, like the Burning Man in the Black Rock Desert of Nevada, or Florida’s Underwater Music Festival, it’s the theme of many which alarms or amuses; Roswell obviously has a UFO Festival. Devon’s Blackawton International Festival of Worm Charming, is a thing. The World Bog-Snorkelling Championships in Llanwrtyd Wells and Ashbourne’s toedium smack down, the World Toe Wrestling Championships are too.

bog
I want to be just like him when I grow up

Wife Carrying Championship, anyone? The wedding vow of husbands metaphorically carrying spouses in times of sickness is taken a smidgen too literally in Sonkajärvi, Finland. Awards for the swiftest, toughest and amusingly costumed pairs are handed to contestants who carry their wives across a 254-metre obstacle course. But at the Festa del Cornuto, outside Rome, the Festival of the Horns, the men of cheating wives’ parade, crying and smashing possessions they gifted them to honour and console their woe.

wife
I’ll give you put the cat out!

Confetti Battle is a tad more family-orientated, like Krampusnacht in Germany, where every December an anti-Santa hands every naughty kid a lump of coal. Why not dress as devils and jump over our babies, because it has constituted a festival for over four-hundred-years in Castrillo de Murcia, Spain? If you think Don Quixote in a Lycra Satan suit leaping over your darling isn’t quite psychologically traumatic enough for them, how about Tokyo’s Naki Sumo, where oversized sumo-wrestlers square-up in a ring, each holding a baby, the contest being the first to make the other’s baby cry? Supposed to ward off evil spirits, so if your kid sees no fear in the wrester, the referee jumps in donning a scary mask to ensure a change of nappy is needed.

APphoto_APTOPIX Japan Crying Baby Contest
Think that’s scary? You should check my nappy, pal!

Some are pleasant, like the Cheung Chau Bun Festival in Hong Kong, where competitors’ climb sixty-foot towers of sweet buns which line the streets. Or the Floating Lantern Festival in Hawaii, and Beer Floating in Finland; steady, floating down a river in an improvised raft gulping Carlsberg. Others equal this pleasantness but add humorous elements, like the village of Brawby, where the Yorkshire Pudding Boat Race takes place over Bob’s Pond.

yorkshire-pudding-boat.jpg.638x0_q80_crop-smart
Who left that sausage in here?

Food leftover fights are commonplace, La Tomatina in Spain, The Battle of Oranges in Ivrea, Italy. I mean, sure, Rayne in Louisiana has a Frog Festival, and turkey testicle eating contests are widespread across the USA. Alongside the sinister Day of the Dead Festival, Mexico has Noche de Rábanos at Oaxaca, or “The Night of the Radishes.”

radish
We are the Radish Army, arm your salad!

Korea has the Boryeong Mud Festival, where if you thought Pilton can get pretty filthy on a rainy July, you should see these lot engaging in mud photography workshops or having mud massages. But mud is great for the skin, ambiguously, especially the Boryeong mud used in their cosmetics. Or the valued tradition of Hadaka Matsuri in Okayama, where 9,000 naked Japanese men wrestle for sticks thrown by a Shinto priest. If the winner puts the sticks into a wooden box with rice, he will be contented the whole year.

mud
Anyone got a chewing gum?

Equally as cringeworthy to me, but hey, you might fancy the Japanese Kanamara Matsuri, or festival of the penis. They have penis artworks (unsure if they’re pictures of dicks or drawn with one, like drawing using a fat, wax crayon in your left-hand,) penis-shaped sweeties and carved vegetables, decorations, and a phallic mikoshi parade. Yet again the logic centres around a shrine once popular for prostitutes to pray for protection from sexually transmitted diseases. But legend has it, a Vagina Dentata demon lurks inside vaginas to castrate young men on their wedding night. If told that, you’d be celebrating the prosperity of your manhood.

penis
I always dress like I’m Nigel Farage

Finland’s Air Guitar World Championships claims the ideology would end wars, stop climate change and eradicate all bad things. So, all of them have a history, or logic behind them, no matter how bizarre they may seem. Peru’s Cat Food Festival, for example, you may think this annual gathering in Cañete, where they munch on cats is to cull an overpopulated stray cat problem, but no, they breed the animals especially for human consumption at the gig. Apparently, cat meat has aphrodisiac properties and also prevents ailments in the bronchi; I’ll skip it and just try the veg, thanks all the same.

At least Thailand’s annual Monkey Buffet Festival isn’t as bad, despite the alarming name, it’s the monkeys who get a feast, not us nibbling on monkey meatloaf. They honour the descendants of a monkey warrior in Lopburi, and it’s a crowd-puller. Seems disease-spreading blood-sucking pests get honoured, The Great Texas Mosquito Festival brings three days of carnival to Clute; food, drink, games and rides, craft or cooking workshops.

monkey
Hey, where’s the KP Skips?

Confetti Battle roots to Carnival in 1913, where confetti and rose petals were thrown by the crowd at people in the procession. The tradition evolved into a fully-fledged battle around 1955, started by Jim Jennings, but the reason is unknown. Maybe we need to make one up; a nobleman’s wedding that went horribly wrong?

bull
I’m just nipping into Greggs

Even bulls rampaging around the streets, averagely injuring three hundred people and killing fifteen at the Fiesta San Fermin, doesn’t stop people gathering and making a festival out of. Why then, should changing our relatively harmless confetti battle from Wednesday to a Saturday bother you?! I’m not suggesting we have a penis fest, or eat cat, but what Devizes has is unique, and could be on this list!

Devizes Confetti Battle
Devizes Market Place – Saturday 31st August 2019
Entertainment starts from 7.30pm
Battle commences 8.00pm


© 2017-2019 Devizine (Darren Worrow)
Please seek permission from the Devizine site and any individual author, artist or photographer before using any content on this website. Unauthorised usage of any images or text is forbidden.


 

Adverts & Stuff Like That!

spidermilkman

wildingcellaeknatiurbanbargevinylrealmnewadvertadsilverfcfemale201965217389_1310844582401986_2449299795982942208_o

We see Same Days

Extensively featuring Devizine’s friend, Finely Trusler, half of Larkin and The Truzzy Boys, a new single from Same Days, a twenty-year-old London born Swindon performer is out for streaming today. Real name, David Whelpdale is cousins with Fin. He’s built an audience since a debut single in April, trying his hand at producing too. With Funked Up Dad, Martin, and Fin’s other cousin, Harvey, making up the other half of The Truzzy Boys, I had to ask Fin if he has any non-musical relations.

“Not many, mate!” was his answer, simple but to the point. Though this is something altogether different, as Same Days adopts that prevalent merger of singing with rap, popularised by the likes of R. Kelly. Yeah, alright, I’d need to speak to my daughter for more present comparisons! Still, old fart or not, I like it; “You See Me” offers a smooth and confident rap which oozes in and out of adroit boyband vocals. With natural ease this slick contemporary composition lustres authenticity with Fin’s acoustic component, harmoniously breathing air away from any unethical stereotype of rap fuddy-duddies may wrongfully spurt!

The accompanying video also assists with this acoustic measure, taking to the woods and other natural landscapes for locations rather than the banal urban scene. See for yourself, and all the best with it guys!


© 2017-2019 Devizine (Darren Worrow)
Please seek permission from the Devizine site and any individual author, artist or photographer before using any content on this website. Unauthorised usage of any images or text is forbidden.


 

Adverts & All That Malarkey!

spidermilkmanknatiwildingcellaefemale2019vinylrealmnewadvertad

Your Friendly Neighbourhood Milkman!

After the results of our dare, I’m going to do it, but not without your help raising some awareness of Carmela’s Stand up to Muscular Dystrophy…..


UPDATE!

Thank you for the kind donations, we’ve made £100 so far, but Spiderman isn’t coming out to play unless we can get some more!! Please donate to my dare, whatever you can will be a great help to Carmela and her family. A big thank you to The Gazette & Herald for covering the story, and Claire Perry MP who retweeted our campaign on her Twitter page.

I was delighted today, as for the first time I met Carmela and her mum, Lucy, when they came for a visit and, if a little hot and bothered, we posed for some photos! If anything though, it’s made it feel so much more real about doing this silly thing!

Img_2770cropcop3crop2

Donate Here!


Writing my rant column about Devizes on Index, some years ago now, would rattle some cages on Facebook. The satire soared over the heads of some conservative-minded individuals. One commented “don’t give up the day job.” I replied, “for the record, I love my day job,” and, weather permitting, I do.

When children say what they want to be when they’re grownup, they tend to suggest jobs they see around them, a teacher, a policeman, something like that. With a love of drinking milk, I wanted to be a milkman, among other things. I’d take the bottles out of my fridge and place them on the neighbour’s doorsteps. They’d knock our door, bottles in hand, saying, “I think he’s been at it again!”

milkfloat.jpg

Forward wind some decades, I figured of all the things, becoming a milkman was as unlikely as my idea to be an astronaut, being supermarkets had seen off the trade. When the job came up at Planks, I gave it a go, and after five years, never tire of it. There’s a tranquillity, a gratifying element to it beyond your average delivery driver. We are the fourth emergency service, supplying milk to those in far-flung villages who otherwise would have to travel some distance. This is warmly appreciated, particularly from the older generation, and with ecological awareness on plastic, the occupation is back in fashion.

Just so you know, Devizine is a hobby, you’ll be sadly mistaken if you think it prints money. Still, love doing this too. It became apparent when I made it a regular joke, readers thought it strange or didn’t believe I was really the milkman, so a month ago I posted video proof. Being I get quite a few strange looks, this day and age, trundling around in a milk float, it wouldn’t make the slightest difference if I did it dressed in my Spiderman onesie; would it? I asked you all if you’d dare me to do my milk round in my Spiderman onesie!

With great milk deliveries must also come great responsibilities, never ran over a hedgehog yet; they’re too fast for me! The poll exposed a slim majority (98%!) dared me to do it. So, I half-heartedly accept the challenge, but ask you to put your money where your mouth is; think we can raise some funds for Carmela, a five-year-old girl from Lavington with a very rare form of muscular dystrophy called LMNA Congenital Muscular Dystrophy? Then, I promise, to dooooo ittttt.

LMNA-CMD is a progressive muscle wasting disease that weakens the skeletal muscles, to the point where Carmela relies on a powerchair fulltime and needs someone to do everything for her. The heart and lungs are affected too. LMNA-CMD is incredibly rare with around only 50 known cases in the UK. Many years ago, affected children would typically die before the age of ten from respiratory and heart complications, but modern intervention has seen an increase in life expectancy. Carmela now has a 60-70% chance of living to sixteen. If lucky, she could make it to her twenties.

carmela1

All parents live to wonder, myself included, to their children’s future and inspire and encourage their success, as I watch my daughter run rings around me, football glued to her feet, I cannot imagine what life must be like for Carmela and her family at times. Though Carmela rarely doesn’t wear a smile. I’m no superhero by wearing a Spiderman onesie, more of a loon, but Carmela is.

Mind you, I received word she prefers Wonder Woman, but to see me in blue starry hot-pants is a step too far!

carmela3

There is no cure or treatment to slow down the disease but to help with the discomfort, pain and stiffness that comes with a progressive muscle wasting disease, Carmela requires daily mobility and stretching exercises, massages, hydrotherapy, swimming, and cycling using an adapted trike for low tone children. As her disease weakens her, adaptations in the garden and specialist equipment will change, costing in the thousands. For more information on Carmela’s story, see here: http://www.carmelasstanduptomusculardystrophy.co.uk/

My spider-senses are tingling, telling me I’ve got to do this, on Friday 9th August, weather permitting. I will take some photos and make a video diary of my morning, travelling through: Potterne, Worton, Great Cheverall, The Lavingtons, Easterton, Urchfont, Chirton, Patney, Beechingstoke, Woodborough, Marden and back into Devizes, before returning to Plank’s Dairy in Poulshot. I’ll also try a live stream to our Facebook page for the last part of the journey, and Carmela may join me at some point too! If this isn’t enough proof for you, I plan to stop outside the Bear Hotel in Devizes, Friday mid-morning where you can meet and laugh, I mean cheer me on!

carmela2

If there is to be a gathering, and any of my musical friends are free, I’d welcome you entertaining the any gathering few with an acoustic song or two, please let me know guys!

On the day, you should be able to track my progress on the Devizine Facebook page, and I’ll announce an ETA back into town; do, if you can support me, there will also be a bucket for donations, or you can use this donation page here. Please, I know times are tough, but one thousand four hundred bods like the Facebook page, near 40,000 of you read the website annually, if everyone just gave a pound coin, it’d make a massive difference to Carmela’s life. She’s such a happy-go-lucky five-year-old, despite this condition, and refuses to let it prevent her from smiling.

Here’s the link, let’s get this to as much as we can, help me by sharing and caring! If Steve Ditko could see me now… probably cry with laughter!

spidermilkmanphoto
Click to Donate!

Adverts & Stuff Like That!

62421161_2547566181944188_7910508312376901632_ocavdischauntedpostnewadvertadknatimelkpartywildingcellaevinylrealmsilverfc65217389_1310844582401986_2449299795982942208_ofemale2019

 

Food Fight!

On the eve of The Devizes Food Festival announcing their schedule, I contemplate what attributes taste, be it class, culture or trends…..

 

You know, we chat and cover a lot of musical genres here, some are picky about what they like, but I think food is even more subjective. After all these years, for example, I just discovered the better half favours apricot jam tarts in an assortment box. That’s just weird, everyone knows the blackcurrant ones are the best and raspberry a close second.

More Facebook group members have fallen out over the great pineapple on pizza debate than Brexit. Forget fights over Oasis or Blur when you throw in a tin of Quality Street and ask them to arrange from best to worst. The other day, right, I took a shark-sized bite from a doughnut only to discover to my absolute horror, some compete psychopath had put custard in rather than jam. What kind of sicko even contemplates that?

custard1
Pure Evil, at Asda

While many children will only eat a thing if it’s endorsed by Spongebob or their favourite superhero, (I appreciate this; love Peppa Pig, especially lying on a bread bed smothered in ketchup,) the affluent will consume any old entrails provided the name of it has been swanked up. Give it a Mediterranean namesake and they’ll pay triple the price-tag. I’m not buying it; crème Anglaise? Custard, mate. Jus, don’t give me jus, it’s watery gravy; stick another oxo cube in it for crying out loud. Fromage et jambon panini, yeah right, it’s a cheese and ham toastie, pal.

baconsandich

Whether it’s pondering if peas should have a home in a pasty, or if gherkins belong in a Big Mac, what divides us all is our taste buds. They don’t rely on gender, race or religion, they just randomly respond to some things better than others, or do they? I mean, tastes can attribute to class; The Queen chomps on swans by the dozen, but I only get penguin biscuits. You can tell my working-class background by the stench of Iceland’s hotdog pizza on my breath. Yet when I spotted in their fridges a chicken tikka lasagne, even I considered it a trailer-trash step too far.

swan

Tastes also fluctuate depending on trends. Have you noticed, no one slices pork now? It’s got to be “pulled.” Pulled pork meant something entirely different when I was a teenager! My gran would slap us if she saw us buy a premade sandwich, yet delis sell them by the truckload. They sell grated cheese in bags, we buy it; have cheese grater, left abandoned, crying in the cupboard.

It also attributes to culture, yet exploited by soundbites like delicacy or gourmet. What may be considered an exotic delicacy here, is actually staple diet elsewhere, because it’s cheap and in abundance. Take maple syrup, so pricey for a drizzle, yet lucky Canadian’s have it running from a third tap!

Maple Syrup Weekend

Rice, couscous and noodles are popular in Asia because they are obtainable and economical, treated like potato and bread here. Yet we lap these things up. There’s posh pubs in East London who sell tourists plates of pie with eel liquor as if it’s a local delicacy, a word usually meaning rare, luxurious food, sophisticated. EastEnders ate ‘pie n mash’ because of poverty, eels were leftovers at the port, just as lobsters were too in North America until the mid-19th century.

By Dickens, how far are you willing to take it, gruel? Japanese Fugu, or bird’s nest stew? Flamingo tongue, a prized dish in ancient Rome. Escamoles in Mexico, that’s ant’s larvae to you and me. Half a million dogs are slaughtered annually for meat in the Philippines; teatime kids! I know we must convert to vegan, but think “bacon” and it’s an ecological step too far for me. I can and will eat vegetarian food, so long as there’s a chicken on the side.

If it’s not the ingredients it the presentation, honestly, I don’t care if it’s slopped on a plate like a car crash, dribbling over the edges, provided it tastes nice. I don’t need to be waiting an extra ten minutes for you to “plate-up,” carefully aligning each faultlessly equilateral chip atop of my cod, delicately garnished with a smudged splash of ketchup and pea puree. That’s if it’s served on a plate at all. Masterchef, right, seems the strength of the “dish” is based upon purposely not being on a dish at all. What’s wrong with a plate? Spaghetti Carbonara served in an old go-kart tyre, beef wellington in an actual welly. Duck-a-l’orange in a paddling pool, minted lamb kebabs on a pavement slab, that kind of thing; nobody order the coq-a-vin.

duck

If I contemplate it’s all a bit much, I digest the Devizes Food Festival have launched this year’s events on a new website, by a new committee. 28th September to 6th October, sets the dates, time enough for you get over my rant about habits in the Philippines. They’ve adopted the pineapple as their logo, but why, you may ask. Interestingly, you can grow pineapples in the UK with use of a polytunnel; who knew and why didn’t they tell me? Because I’d go scrumping no doubt; blinkin’ love pineapple, me.

fooddrink

Partly because the pineapple is a symbol of hospitality and friendship, the connection is Adam Taylor’s ‘A Gardener near Devizes.’ Published in 1769, there’s a treatise on how to grow a pineapple. No polytunnel needed to heat it, he used a horse manure pit, probably for the first time too. This pineapple hothouse meant smaller estates could afford to serve pineapple, but did Adam order it as a topping from Dominoes, I ask you?!

For the duration of the festival you can pick up a Pineapple Trail Sheet (for a small contribution) from Devizes Books or Wiltshire Museum during the Festival, and hunt for Princess Pineapple, and her eleven friends, peeking out from shop windows throughout Devizes. The Museum will also hold a display on the Pineapple, both in the treatise, and local architecture; yeah, you seen it too, just can’t think where!

pineapple

The Devizes Food Festival has a varied range of events. Devizes Mayor Judy Rose will be officially opening the Festival at the Corn Exchange for a FREE World Food Lunch on Sunday 29th September from 12.30. There you can explore the globe on a plate. With a handful of 50p vouchers to exchange, local residents with far flung roots invite you to sample a family favourite from their homeland, from the cuisines of Poland, New Zealand, Ireland, Kazakhstan, Fiji, the USA, Scotland, France and plenty more nations of the world. I asked if I could rustle up my Essex-stylee beans on toast speciality without response; what? It’s got Maldon sea salt on it.

Many other events seem to be about eating in strange places; Town Hall lock-up, Kennet Furniture Refurbiz, the bell tower at St Mary’s and even Erlestoke prison; porridge anyone? There are the usual food quiz and Come Dine With Us events, visits to Wadworth, a’Becketts Vineyard in Littleton Panell, East Farm at Winterbourne Monkton and a pumpkin prowl at VP Collins, Bromham. Oh, and it’s pizza time at Vaughan’s Cookery School. Peter, please divulge your opinion on pineapple on pizza.

peter

Check the website for details, of course the grandest moment in the Festival is the marvellous market, on the 28th September at the Market Place. I had a feast there last year, enough me to stop fussing about apricot jam tarts, custard doughnuts, Escamoles and why pork has to be pulled rather than sliced these days. Guess I’m obsolete, pass the prawn cocktail and switch on the teasmade.

market


© 2017-2019 Devizine (Darren Worrow)
Please seek permission from the Devizine site and any individual author, artist or photographer before using any content on this website. Unauthorised usage of any images or text is forbidden.


 

Adverts & That!

62421161_2547566181944188_7910508312376901632_ohauntedpostmelkpartywildingcellaenewadvertadfemale2019vinylrealm65217389_1310844582401986_2449299795982942208_o

REVIEW –Vince Bell – 7th July 2019 @ The White Bear, Devizes

VB @ the WB!

Andy Fawthrop

 

OK so it’s the day after the (wonderful!) Devizes Beer Festival and you’ve worked your way through the hangover. You’re starting to feel normal again, but the sun is still shining, the world is still a beautiful place, and you really don’t want to start thinking about Monday just yet. What you gonna do?

Well, here’s a possible solution – head on down to the White Bear. Let me explain.

The White Bear (one of the oldest pubs in Devizes, blue plaque on the wall, blah, blah, blah) is rather on the up over the past few months. New landlords Marc & Georgie have been transforming the place since they moved in. Not only do they have an agreement with Wadworth that the pub can also supply a limited range of non-Wadworth beers on their pumps, and not only has chef Marc shaken up the menu with some glorious and interesting new food choices, and not only do they have some wonderful B&B accommodation, but now they are experimenting with providing a new laid-back music venue.

vincebear1

The plan is to feature a different artist every Sunday in the 5pm to 7pm slot, in a small, intimate venue with good food and beer, and to create a pleasant and laid-back vibe, perfect for winding down the week-end.

First up this Sunday was local musical hero Vince Bell. But before he took to the mic we had a great support slot from Fraser Tilley, who turned in an enthusiastic and lively set featuring both original and covers material (Marvin Gaye, Stevie Wonder, T. Rex and others). He in turn was supported by drummer Tim Watts, laying down some very gentle percussion accompaniment (having played with It’s Complicated at the previous day’s Devizes Beer Festival). The two of them provided exactly what was needed – an uncomplicated (geddit?) drift of songs that had the audience listening and applauding.

After a short break, Tim stuck around to accompany main man Vince. Last time I saw Vince was a few weeks back at Long Street Blues Club, playing support act to Skinny Molly in front of a very large and noisy audience. On Sunday the audience was much smaller, much more intimate, but equally enthusiastic. Vince seemed relaxed and quickly established an easy rapport with the assembled crew, which (obviously) included many local friends. His choice of material was good, mixing his own self-penned numbers, with a few covers including those from a certain Mr Bowie, the Killers, David Gray etc. For an encore he asked the audience which they’d prefer – one his songs? Or a cover? The audience wanted both, and that’s what Vince obligingly delivered.

vincebear2

So, for the launch of yet another musical venue in The Vize, was it a success? An unequivocal thumbs-up from here – good venue, good beer, good food, nice cool atmosphere and, of course, some great music.

Future gigs are to be announced, but next Sunday (14th July) is already lined up with Bristol-based singer/ songwriter Andy Juan.


© 2017-2019 Devizine (Andy Fawthrop)
Please seek permission from the Devizine site and any individual author, artist or photographer before using any content on this website. Unauthorised usage of any images or text is forbidden.


 

Adverts @ All That!

newadvertad62421161_2547566181944188_7910508312376901632_ocavdischauntedpostmelkpartywildingcellaefemale2019vinylrealm65217389_1310844582401986_2449299795982942208_o

Devizes First Scooter Rally; A Historic Weekend

Chatting to Gouldy of the Daybreakers, due to play Minety Festival the following day, we mutually complimented the setup at The Devizes Scooter Rally. Pleased for his input, as there was always a risk, being this is my first scooter rally, that any review would be comparable to a festival. Prior to the event, I admit I was mindful to this, telling myself not to hype it, as it’s a scooter rally, not a festival. Yet Gouldy described the archetypical rally as lesser in design and setup than your average festival. Given this notion I encouraged The Scooter Club to embrace wider appeal; they were in agreeance, it wowed and will undoubtedly go down in Rowde’s history.

This paid off, for two years in the planning, and some bumps between us along the way, the Devizes Scooter Rally was uniquely designed and executed with individualism and panache, binding a positive festival vibe with the style of a scooter rally, surely producing an event to shame other similarly labelled events; and all for the first time too.

scooter2

Booking The Tribe, Swindon’s hip hop-reggae whizzers, popular on said festival scene, was attributed to this notion; partly my suggestion, but to open wasn’t. Perhaps this wildcard could’ve fitted later, yet, their wider appeal indeed took the younger’s interest, even if not digested by traditional scooterists. They played an arresting and dynamic set as always, rapper AJ Mayhew joining the slight crowd for a dance momentously inspiring for the younger.

More so, it was the plentiful choice of food stalls, bars and side attractions which blessed this event with that genuine festival feel, as opposed to the average rally’s hashed barbeque, hosted by the least drunken skinhead, and the bar being the pub across the road! All slight, but there were fair stalls, rides and a bouncy castle to keep young ones amused. Food stalls of pizza, noodles, burgers, hog roast varied catering, retro clothes stalls and the Vespa Owners Club had travelled afar to join many local ventures such as Vinyl Realm holding their first stand.

Aside the brilliant homemade bar, with pumps and Pimms, which was reasonably priced even for a pub, let alone event, choices were also available, from separate coffee or Prosecco bars, and the strikingly Caribbean yet local rum distributor Muck & Dunder’s mobile bar, which I could make my second home!

20190706_172017

So fruitfully the Scooter Rally developed, combining the favourable elements of festivals and scooter rallies equally to create what they wished, done their own, localised way. Villagers and Devizes residents mingled with widespread scooter aficionados in a joyful ambience. Meeting enthusiasts who’d journeyed from the North, or Exeter, was amalgamated with strictly Rowde branded humour, such as parish councillor, dubbed “Rowde Mayor,” John Dalley, who had his head shaved by Tracie Lawson of Devizes Beauty Boutique for children’s cancer charity CLIC Sargent.

20190706_212249 - Copy

Late Friday evening, drinks may’ve flowed, but chatting to DSC Colonel, Adam Ford, there was little doubt, though the monumental organisation thrusted into an event of this calibre, that he’d do it all again, next year. For when it came together, a fabulous time was had by all and full marks must be awarded to all members of the club.

To nit-pick there will be lessons learned, the PA needed a little hoof, least villagers only went to their Facebook group to inquire where the wonderful music was ascending from, rather than complain. This came to a head at the concluding act, Bad Manners tribute, The Special Brew, who worked professionally through technical faults to bring a madcap finale we’ll be talking about for years to come. Lighting and washing facilities for those camping, may also have been on the hitlist, though elements ramp the ticket stub, and it was ever kept a reasonable price.

20190706_221145

Friday then, and local folklore heroes, The DayBreakers followed the Tribe, with their wonderful brand of folky-retro-pop. South-coast’s ska legends Orange Street headlined with a tight and proficient set of ska and two-tone classics, they simply astounded, leaving us with little doubt the weekend was a winner.

Trilbies must also be raised to the solo effort from renowned DJ Terry Hendrick in the marquee, who both filled in whenever necessary and bought each evening to a climax. Neither angered by my pestering, browsing his astounding collection of seven-inch rarities, he even allowed me a little taster on his wheels of steel!

20190706_160300-copy-2.jpg

Local retro covers band, Cover Up did a grand job opening Saturday’s live music, upon the return of the scooterists on a ride-out across Devizes and villages, parking by the stage for browsing devotees. For me, the highlight was always to be Swindon’s Erin Bardwell Collective, whose rock steady and boss reggae classics appropriately fit the sunny afternoon breeze. As well as Double Barrell, Let Your Yeah be Yeah, and Jackpot, there was a sublime cover of Horace Andy’s Skylarking, a blend of Harry J’s Liquidator with Staple Sister’s I’ll Take you There, and just one of their own songs, a new one called Just Loving You.

20190706_17261120190706_163620 - Copy

The Start bought the event to boiling point, Essex’s finest gave us a loud and proud varied performance, shelling us with iconic Two-Tone and sixties to eighties mod-rock anthems which defined the eras. The Start were confident and highly enjoyable, rousing the crowd for Special Brew. If it was an unfortunate technical fault, worry didn’t project dismay, they battled through and such was the unabridged event, it mattered not.

20190706_203305 - Copy

What a marvellous weekend, possibly the most bizarrely enlightening the village has ever seen, unless you different? Detroit USA, Kingston Jamaica, London, New York and Coventry; all established places on the soul & reggae map. Thanks to Devizes Scooter Club, we can now add Rowde to that map!

scooter3


© 2017-2019 Devizine (Darren Worrow)
Please seek permission from the Devizine site and any individual author, artist or photographer before using any content on this website. Unauthorised usage of any images or text is forbidden.


Adverts & All That!

female2019cavdisc62421161_2547566181944188_7910508312376901632_o65217389_1310844582401986_2449299795982942208_onewadvertadvinylrealmmelkpartycavifestskittles

REVIEW –Watermelon Slim – 28th June 2019 @ Long Street Blues Club, Devizes

A Fruitful Night

Andy Fawthrop

Final gig of the current season at Long Street Blues Club, and we went out with a bang with two great acts.

First up was local bluesman Andrew Bazeley. Having made this style of music his life-long hobby, I’d go so far as to say that what this guy doesn’t know about Delta Blues just ain’t worth knowing. He lives and breathes this stuff, and this is reflected in his playing – soulful, bluesy, stripped-back, atmospheric. His introductions and between-song patter are a delight for anyone who wants to know something about the songs they’re listening to – informative without being preachy. He told me before the gig that he was nervous, but it didn’t show one little bit. And afterwards said that it was probably the biggest audience he’d ever played to. No worries – the boy done good.

slim1

Then the main act. Two sets of howling, rasping blues from the trio fronted by Watermelon Slim. We started off, very unusually, with the main man introducing his band – before a note had even been played! But after that it was down to business. Slim himself alternated between playing his guitar lap-style on a table and his trusty harmonica, but always ably supported by solid drums and bass. The vocals were howling and husky-voiced, the playing effortless. The banter was self-mocking (“almost 50 years now”), drawling and laconic, betraying the man’s Deep South origins. Frequently Slim came off stage and into the front of the crowd to let his howling harmonica do the talking. And he talked a lot, and with laid-back humour. At times the performance felt a little hammy and hackneyed, pushing all the usual I’m-a-great-bluesman buttons but – hey – he IS a great bluesman, so who’s complaining? The audience certainly weren’t, lapping up both the chat and the music.

The start of the second set was my highlight – leaving his buddies backstage for a while, his opening number featured just acapella voice and that screaming harmonica – absolutely sublime.

slim2

It was a great finish to the current season, and I’m already looking forward to the next one. Ian Hopkins was very happy to discuss his forward booking plans and mentioned a few names, but I won’t steal his thunder until the new season is announced in full later in the year.

Great club, great venue, great artists and superb entertainment. A real advert for live music in our town.

 

Adverts & All That!

ScooterRallyposterNovskittleshauntedpost62421161_2547566181944188_7910508312376901632_omelkpartynewadvertad65217389_1310844582401986_2449299795982942208_ovinylrealm

 

Chatting Carnival with Loz

With a nail in the offside rear tyre, I’ve got a three-quarter of an hour window to nip to Mike Woods and stop for a drink at Times Square before the school run. Prioritise Worrow, prioritise; erm, just a cup of tea thanks, you get a little biscuit on the side anyway.

Loz Samuels beats me hands down when it comes to time management, it’s her second visit to coffee shop today, chatting and encouraging the progress of DOCA. Whenever I catch her, Loz laments how crazy it’s all been, yet I suspect she wouldn’t have it any other way. Appears to me she personifies the satisfaction of commitment so much it’s scary; procrastination not in her agenda, unlike me who lives by its golden rule.

loz.jpg

Skipping the announcement of Vinyl Realm’s second stage at the Street Festival, as despite being the reasoning for arranging the meeting, I measured both Pete and I too enthusiastic about the prospect to wait till now. Seems Loz wanted to concentrate on the subject of carnival and the nearby sub-events, opening with a partnership project with Amesbury Carnival. “We’ve created a six-feet high puppet of a mammoth,” she explained, confirming after some deliberation of the crane’s availably, it will stomp its way through our procession.

I note it’s the kind of thing you see at carnivals in South America or the Caribbean. “Yes,” she agrees, describing a second mahoosive moveable puppet of a Neolithic woman, “it’s quite colourful, because the theme is Through the Ages, so it works, it works well for them (the sponsors) because they wanted something to do with heritage.”

There was me thinking about an old British Pathe film showing a Devizes carnival of yore, but Loz explained the theme is more general, not as I thought, a historical look at Devizes Carnival. “No, just through the ages, you know, could be the future, could be aliens, but maybe someone will interpret it like that.”

So, carnival is on the 13th July this year, a change that’ll bring the walls down and make life no longer worth living, according to “traditionalists” on social media. In our last chat with Loz, we enlightened the reasoning for the change, aside the fatigue of DOCA’s volunteers with a full fortnight of events, the hesitancy of schools to contribute during summer holidays has opened up. Schools are able to work on their projects earlier in the year, and workshops have been running in seven participating schools, with others coming. The theme, Loz explains, is suitable for their curriculum too, be it Victorians, or pirates for example; one positive reason to change. Loz stressed how pleased she was with this change; carnival wouldn’t be carnival without the children.

Colour-Rush-Featured-image.jpg

We move onto the notion that the subevents, the Colour Rush and the strictly Devizes “thing,” The Confetti Battle can now be on a Saturday too, rather than weekdays as previous. “So hopefully,” she nods, “there will be masses there. We had four thousand there last year, and on a Wednesday night when you’ve got to get up next day, it’s quite late….”

“It’s going to be different every year, I mean,” she continued, “how many times are you going to go to Confetti Battle when it’s the same old thing?”

I agreed, despite my kids loving it when younger, they consider they’re getting too old to bother. “But they might do this year,” Loz interrupted ardently, “because there’s gonna be massive inflatable crazy things that’ll appear in the crowd!”

Loz’s hopes for additions to this year’s Confetti Battle are from Willy Wonka’s rulebook, golden tickets to win £50 in the bags of confetti, and more side attractions will add to its appeal. “The Confetti Battle could be nationally known,” she continued, comparing its potential to the Cooper’s Hill Cheese Roll, “but not on a Wednesday night. People aren’t going to be travelling from, say, London on a Wednesday night.”

bunting.jpg

Confident to grow this unique element of our carnival, Loz continued to express advantages of the battle commencing over the weekend, taking down the rigs in order for market the following morning will be a thing of the past, meaning a more elaborate setup. She had a meeting with the astatically pleasing festival, BoomTown, aiming to create a visually stunning spectacle with wider appeal.

If cynical of her ambitious outlook, Loz claimed, “the sky’s the limit, if we can raise money to put into it, then we can do it, we can do anything, so, it’s a start, I’m aware people are sceptical about changes but if we stay as we are, we’re not going to grow, we’ve no potential to make money, our arts funding will decrease.” Seems logical to me. We talked of possibilities, of Caribbean carnivals where the procession concludes into an arena for a concert afterwards. “I think it’s really exciting,” she stated, “doors are opening now.”

The crucial thing to note in this chat, is that this is only Loz’s third year at the helm, finding her feet has been uphill, with a system only documented only in her predecessor’s head. She now feels in a position to build on past experiences and deliver us the large-scale outdoor events we will be talking about through the forthcoming ages.

So, let’s get things straight right now, DOCA’s program of events is ever as lively, but with a few changes:


Saturday 6th July: Carnival Costume Making Workshop @ Wiltshire Museum:

Help prepare a large-scale costume to walk in this year’s parade. Families and children aged 8+ are invited to make some spectacular back pack style costumes. This will be a group making session working on revamping backpacks which will match with costumes made by our school groups, in either Medieval, Tudor, 18th Century, or Victorian style.

Artist and costume designer Abi Kennedy will guide you through making a colourful back pack, a fun and creative afternoon is promised. No experience is necessary.


Wednesday 10th July: Skittles Night @ The Wyvern Club

skittles


Saturday 13th July: Devizes Carnival Through the Ages.

Entrant registration from 4pm, Procession starts at 6:15pm.

62421161_2547566181944188_7910508312376901632_o


Sunday 18th August: Picnic in the Park @ Hillworth Park


Sunday 25th August: International Street Festival @ The Green


Monday 26th August: International Street Festival @ The Market Place

vrstage


Friday 30th August: Kennet & Avon Canal Trust’s Music by the Canal

6.30pm until 10pm @ Devizes Wharf.


Saturday 31st August: The Colour Rush

Starts at Green Lane Playing Fields and finishing in Market Place.


Saturday 31st August: Confetti Battle @ The Market Place

Confetti-Battle-featured-image


UduL by Los Galindos @ The Green
Los-Galindos-UduL-photo-by-Manel-Sala-Ulls-300x450.jpg

An award-winning Catalan circus company who inhabit a traditional Mongolian yurt which will be located on the Green for three days. Saturday 24th August: Doors 7pm Show 7.30pm, Sunday 25th August: Matinee Doors 1.45pm, show 2pm. Evening Doors 7pm Show 7.30pm, and Monday 26th of August: Doors 7pm Show 7.30pm. Minimum age recommended from 7 years. TICKETS: £5 Early bird price until 31st July, thereafter: £7 each, £5 for under 16’s.


Shop Window Competition

Shops around town have placed one item in their window, during Street Festival fortnight, that they don’t normally sell. Spot them all and be in with a chance of winning £25! Entry forms will be available online throughout the Street Festival Fortnight or from Devizes Books and the Town Hall. Completed forms can be left at the Town Hall.


logo230.png


Adverts & All That!

newadvertaddedicoatScooterRallyposterNovsharoncrabbehauntedpostmelkparty62421161_2547566181944188_7910508312376901632_o65217389_1310844582401986_2449299795982942208_o
vinylrealm

 

Devizes Nights: At the Southgate, Jon Amor, One and All

Images by Nick Padmore

In that year of the breakdancing fad waning my brother went off and bought Born in the USA, and we became Boss fans overnight. So, he nipped out and bought Nebraska too, and we were like, “oh…”

It took some time for my infantile mind, accustomed to pop, to appreciate acoustic, but as I listened to those dark portrayals, I saw the worth of the simplicity of just a person, a guitar and maybe a harmonica for good measure. I understood now, if a musician can strip back his music to the bear minimum and still captivate, they were among the most highly accomplished.

As Jon strummed the most popular song on his Colour in the Sky album, Red Telephone, singing “why don’t you call me on red telephone,” then adding “it’s 01380…” it produced a belly-laugh. I doubted it would elsewhere, being the audience recognised it as their own area code. I then considered if I need review this gig at all.

For Jon Amor is to Devizes as Springsteen is to New Jersey. He was among natives last night and with stripped back versions, some amusing covers and local banter, all knew what they’d come for. Do I really need to elucidate his excellence on a website with a commonly Devizes demographic?

jonsoothgate1

Do I need to outline how great the evening was and what great company we were in, being over the last year and half, the Southgate has become widely known as Devizes haven for live music and friendly, grassroots atmosphere? It’s rough and ready, it makes do with what it has, but the Southgate is, simply, the best pub in town for music, through dependability. You can scroll through Devizine to see what’s going on locally, don’t let me put you off that, but if you’re ever stuck for something to do, you need not, just head down there, because nearly every Friday and Sunday, and defo each Saturday you’ll find a cracking band or solo artist doing their thing without regulations, without pretence.

During the week it’s either quiz night or an acoustic jam Wednesday, we know what Deborah and Dave have blessed us with, need I really go on? It is Sunday, for crying out loud! I left only a two-word note on my phone for this review, “Word Up,” a reminder that Jon did a comical cover of. The rest of the time was spent catching up with friends amassed for Mr Amor, for free, as that is the ethos of the Southgate. So, do I really need to review this evening, when everyone who is anyone in Devizes attended, even both Devizine’s roving reporters? Maybe I could delegate the task to Andy?!

jonsouthgate2

Do I even need to whip out my little… (wait for it) … camera, when our own Nick Padmore is stood at the front with his sizable lens? Ack, I suspect you’re thinking now, lazy bugger; probably hungover. But truth be told, after walking uphill to town from my village for the past few weekends, I couldn’t face it this time, so I drove. Proof with the cracking combination of Jon Amor and the Southgate, with this blagger’s addition it was free, and so many gathered to chew the ears off, I needed not to intoxicate myself to have a blinding night. Shit, does this imply I’m mature? Bugger, I need to make up for lost time and have a Sunday afternoon drinkie. That’s me out of here, and no doubt unconscious on the sofa right after dinner!

Yet one thing you can be sure of, you need not feel sorrow if you missed it, The Southgate, check it out on our event guide, will continue to bring us many a grand and memorable night with Devizes written all over it, even if the enormity of Jon Amor is rare, you’ll never not be entertained by brilliantly sourced live music. Amen.


© 2017-2019 Devizine (Darren Worrow)
Please seek permission from the Devizine site and any individual author, artist or photographer before using any content on this website. Unauthorised usage of any images or text is forbidden.


 

Adverts & All That Malarkey!

vinylrealmdedicoatScooterRallyposterNovskittlesmelkpartyhauntedpost

cavifest

newadvertad.png

REVIEW –Skinny Molly – 21st June 2019 @ Long Street Blues Club, Devizes

Sweet Home Devizes

Andy Fawthrop

Just when you think the current season is over at Long Street Blues Club, Ian Hopkins sneakily adds a couple more gigs.

First up on tonight’s Friday gig, playing support, was local troubadour Vince Bell who delivered his usual thoughtful and well-polished set. Vince doesn’t always play the most cheerful or upbeat songs but, as he remarked later, he tends to go with the flow of whatever mood he’s in at the time. The audience didn’t give too much of a toss about that, judging by the well-deserved applause he received.

vincebelllsbc

Then Skinny Molly, a Tennessee-based four-piece, hit the stage to thunderous applause and got straight down to work. From the very first minute we were in rock territory, with heavy driving bass and drums, fronted by a pair of hot guitarists who meant business. This was loud-and-proud, take-no-prisoners rock and roll. And the guys looked the part too – plenty of black leather, hats, long hair, tattoos. Sounded like a rock band, looked like a rock band. All boxes ticked.

A couple of numbers in and the band hit Steve Earle’s Copperhead Road at full speed, an absolutely belting version of this great song, quickly followed by the band’s own If You Don’t Care, complete with squealing guitar solo. The crowd was getting warmed up now and we knew we were in for something special. The Devil In The Bottle served up all the standard licks, followed by a stunningly good version of Free’s Wishing Well.

Only after this did the band rein it in a bit to draw breath and to indulge in a little chat and audience participation. But then we got lots of good stuff about “the look” and how their wanderings around Devizes earlier in the day had gone down with some of the locals. Sainsbury and Poundland will never be the same again.

skinnymolly2

But then we were back to the music – including Sweet Home Alabama (what else from the children of Lynyrd Skynyrd??) which turned into a bonkers dance-floor-filler. Following rapturous applause we got a double-number encore, culminating in (what else?) Freebird, which morphed into a belting long jam of a number before everyone retired to a darkened room to have a quiet lie-down.

Great band, great gig.

Tickets still available for next Friday’s gig at Long Street Blues Club – Watermelon Slim, one of the blues greats.

 


© 2017-2019 Devizine (Darren Worrow/Andy Fawthrop)
Please seek permission from the Devizine site and any individual author, artist or photographer before using any content on this website. Unauthorised usage of any images or text is forbidden.


 

Adverts & All That!

jonsouthgatereggaemarldedicoatScooterRallyposterNovskittleshauntedpostmelkpartycavifestvinylrealm

Mod R&B Legend, Georgie Fame Coming to Devizes!

Update:

Tickets for Friday 8th November are Here!

 

I’ll probably get told off by my mum for adding this photo, but I love it. My parents and friends at a dance in Shoreditch Town Hall, 1964. Dad captioned the bands were Screaming Lord Such and The Rockin’ Berries. How cool those mods looked!

shoreditch20town20hall.jpg

Zip forward to 2004 and tired of taking my mum to see mod legend, Georgie Fame, my dad dropped us off in Camberley. It was an awesome night, he played a homage to Ray Charles who had passed that week, and told some great stories. One about Mitch Mitchell, the drummer in his band, the Blue Fames. After checking out an American guy in a club nearby their gig in 1966, Mitch ran back to tell the band how awesome he was, and was soon signed to The Jimi Hendrix Experience.

Georgie’s son played guitar at the event, did an amazing solo of Hendrix’s Red House. And of course, Mr Fame, aged sixty-one at the time and still looked cooler than the mods in this photo, played his plethora of hits, “Yeah Yeah,” “Do the Dog,” and “The Ballad of Bonnie & Clyde.” Though I don’t recall my personal favourite, “Somebody Stole my Thunder,” a mod classic which still gets people up today; I know, played at the Scooter Club’s family fun day.

Georgie_Fame_in_Sweden_1968

With my mum, incessantly inquiring if I thought he’d remember a club in the East End he used to play at, regularly in my earlobe becoming somewhat irritating, after the gig and standing waiting for my Dad to pick us up, I noted Georgie gathered with just a handful of people by a car. “I don’t know!” I huffed, pointing the figure of this senior chap out to her, “why don’t you go ask him?!”

My mum quivered like a star-struck teenager, “oh no, I couldn’t possibly do that!”

“Ahk! He’s standing right there!!” But alas, anxiety got the better of her. It pushed into my mind, that we were all young and impressable once, we all idolised heroes. Yet, though I may shudder to recall some of my own lax, eighties idolisations, I have to admit, Georgie Fame would’ve been one cool one to follow, if I lived in that era.

But time is an illusion my friend, for just when you thought we’d seen the end of The Devizes Arts Festival for the year, they today whack us with the announcement Georgie Fame is coming to Devizes on Friday 8th November, playing a one off at the Corn Exchange. I knew this, Margaret whispered her secret some weeks ago, been aching to announce it since!

gegiefame

I will let you know when tickets are out, but this fantastic news. This Lancashire lad is a legend on the rhythm and blues scene, played alongside rock n roll heroes like Gene Vincent and Eddie Cochran, and an idol to mod/soul aficionados as one of the first British Caucasians to be influenced by ska. Whether you lived through the sixties or not, this is an absolute teaser to forthcoming Arts Festival events, and I thought I was done praising them for the year!


 

© 2017-2019 Devizine (Darren Worrow)
Please seek permission from the Devizine site and any individual author, artist or photographer before using any content on this website. Unauthorised usage of any images or text is forbidden.


 

Adverts & That!

jonsouthgatereggaemarlmelkpartydedicoatScooterRallyposterNovhauntedpostcavifestvinylrealm

REVIEW –Devizes Arts Festival Fringe – Josephine Corcoran – 16th June @ The Vaults, Devizes

Penultimate Parade of Poetry

 

 Written by Andy Fawthrop

Images by Gail Foster (except the one of Gail Foster)

 

Another gig on the final day of Devizes Arts Festival, and something a bit different for the penultimate performance of the Free Fringe – a nice portion of poetry.

Down into the dungeons of The Vaults for this one – a perfect venue for a spoken-word event (The Vaults doesn’t have a music licence). After availing myself of an appropriate libation from the wide range of craft keg and cask beers/ lagers/ ciders in the upstairs bar (where the staff were still recovering from the shock of actually getting to see and serve our esteemed leader Darren the day before [They were delighted Andy, didn’t even take my cash- Ed],) I descended into the cellar to meet the very charming Josephine Corcoran. Josephine is not only a poet, but also a playwright (having had two plays performed on BBC Radio). She also runs a regular poetry group in nearby Trowbridge.

A goodly-sized audience (including a few poetry virgins) had assembled and enjoyed two sets of poetry. In each set Josephine read both from her latest publication (“What Are You After?”) as well as some newer unpublished poems, followed by half a dozen or so local contributors in an “open mic” slot. Josephine’s contributions were thoughtful, personal and close to home, as we learned from her careful introductions to each piece. The efforts from the floor varied in style and tone (including Gail Foster’s fine villanelle regarding the passage of time and of people), comic reflections on luxury toilets and on sex, together with more personal and reflective pieces on topics such as loss of loved ones, memory, separation and even anger. Standard stuff for a Sunday afternoon down the Vaults really. But, seriously, a hugely enjoyable and well-attended event. Hopefully we can do something similar next year too.

Josephine’s latest book is called “What Are You After?” (published 2018 by Nine Arches Press) and you can find out more about her, and her poetry, at www.josephinecorcoran.org

The Vaults’ Poetry Group meets monthly at 7pm on various dates TBA. Next meeting is on Wednesday 26th June. Each month a theme is set as a prompt to inspire new work. You can come with your own work, bring poetry by someone you admire, or just come for a listen. This month, a topic suggested by the latest guest at our table is “Addiction”. Who knows where that one will go? It’s sure to be deep, with a smattering of the light-hearted and supportive conversation that is the hallmark of this poetry group. Work, screens, exercise, love – the scope for addiction is as diverse as the waves on the sea, but is there a thread that links them all? Bring along your work and let’s explore together.

And well done (yet again) to Devizes Arts Festival for putting this on as a Free Fringe event.

Adverts & All That!

melkpartyreggaemarlvinylrealmcavifestskittlesjonsouthgatededicoathauntedpost

REVIEW –Devizes Arts Festival Fringe – The Hot Club – 16th June @ Three Crowns, Devizes

Hot Club, Cool Atmosphere!

Andy Fawthrop

 

The final day of Devizes Arts Festival, and a day that featured some of the Free Fringe Events.

Seems like a long time ago (was it only last Summer?) that I was in the rather pleasant courtyard of The Three Crowns listening to some good music on a lazy Sunday afternoon. But here I was again, and it all came flooding back in an instant.

Founded and led by guitarist Alex Bishop, The Hot Club consists of various combinations of musicians in various formats, ranging from a simple two-guitar set-up, all the way up to a full six-piece. They meet up at The Pound Arts Centre in Corsham, where Alex is usually based. Alex also has a local folk trio called Effra.

andyhotclub.jpg
Our roving reporter Andy caught on camera! Image by Gail Foster

Anyhow, the music for today’s occasion was provided by a trio of instrumentalists (two guitars and double bass), three very relaxed guys knocking out some classic 1930s gypsy jazz tunes in the style of Django Reinhardt. This style of music was born in the pavement cafes of Paris, so I suppose a courtyard of a pub in Devizes is a pretty close match, right? Anyhow, the atmosphere was swinging and relaxed (chilled? yes- even in the welcome sunshine!). The packed crowd loved it, and even the (well-behaved) dogs were barking in appreciation. The wind occasionally tried to lift the small marquee, but no-one was going to let the elements spoil what was a thoroughly enjoyable afternoon.

If you want to know more about The Hot Club head over to www.hotclubjazz.co.uk . They seem to be very popular for weddings, parties and private functions!

I’m sure there’ll be more Sunday afternoon gigs in this great venue over the Summer, so watch out for announcements from The Three Crowns on Facebook.

And well done (yet again) to Devizes Arts Festival for putting this on as a Free Fringe event.

Adverts & All That!

jonsouthgatereggaemarlskittlesdedicoatScooterRallyposterNovhauntedpostmelkpartycavifestvinylrealm

 

Grupo Lokito Brings a Cuban-Congolese Fusion to Devizes Arts Festival

Images by Gail Foster

 

Can’t come out to play today, despite the finale of Devizes Arts Festival is all totally free. Three fringe events across town; The Hot Club (opps, nearly typed hot-tub then) at the Three Crowns at 1pm, Josephine Corcoran reading her poems and an open-mike session at the Vaults at 5pm and last, but not least, they’ve Circu5 closing the festival at the Cellar Bar, Bear Hotel at 8pm.

g6

For me, what’s been the best Devizes Arts Festival line-up ever, came to an explosive and marvellous conclusion last night when the Corn Exchange filled with the absolutely unique and gorgeous sound of Grupo Lokito. A packed Saturday night of the widest demographic you’d expect in Devizes, proves word is out; they’ve made a fool of anyone who attains this pompous, straitlaced pigeonhole they’ve so wrongly picked up. It has been a surfeit of talented and quality entertainment, amazingly diverse, and something our town should be very proud of.

g3

My thanks and praises go to all the organisers, who’ve worked their socks off but retained a smile and positive attitude throughout. So as the band members of Grupo Lokito mingled in the foyer, there was an atmosphere of delight for if this sundry group blend into a city’s world music setting, they were certainly a breath of fresh air in Devizes.

g5

The further away our ears travel from our perceived impressions of music, taken from what we’re exposed to at home, the harder it is, I think, to pinpoint and define the variety of styles. That’s what makes world music so fascinating. But, without recognisable covers or pastiches, and such a free-flowing sound, it does make a review somewhat tricky to write. Not helped by our brilliantly informative interview with Grupo’s keyboardist and manager Sara McGuiness, who outlined the nature of the band’s style.

g10

It intrigued me, Sara labelling the sound of the Buena Vista Social Club nostalgic and polarized, despite its positive effect in spreading Cuban music, to just how this night was going to go down. Indeed, Salsa dance classes had congregated, with their magnificently sassy style and gracefully romantic moves, yet I questioned if the music fitted. Salsa dancing tends to make use of traditional Rhumba, this was definably not. It was contemporary dance, do-what-ever-you-like dance, so while the salsa dancers didn’t look out of place, some arbitrarily bobbed along (myself included) and others tried to mimic the frontmen’s choregraphed hip movements, like guests on the Generation Game, none of it mattered. The concentration was on pure enjoyment of this glorious and peripheral style of music and it was thus.

g9

Evenly paced throughout, I observed this Cuban-Congolese fusion ecstatically. Noticing African sounds, like township jive in a particular tune, only for the next to be decidedly Cuban, and what followed them, a curiously exciting blend of the two to the point it neither mattered nor favoured one over the other; it’s just marvellous music without labels.

g4

I tingled when popping back to the foyer to ensure Devizes Market Place still existed and I wasn’t at Womad, informing photographer Gail it felt like I was on was holiday, a holiday I couldn’t actually afford!

g2

And that, in a nutshell, is the indication of a quality and exotic night. A big group hug for the Devizes Arts Festival, what a super conclusion…. Can we book Ziggy Marley next year, otherwise how are you going to top that?!

 

Adverts & All That!

vinylrealmdedicoathauntedpostlegallyblondeheadcavifestjonsouthgatequizconsskittles

Just Comedy Friends; Ed to Follow

Broken Down on the M25 Wednesday, the Devizes Arts Festival comedy event, Ed Byrne and Friends unfortunately altered to just friends.

 
Then the mobile rang…. A call from Beano artist Kev F. On any other occasion this would’ve been a most welcomed call, but I was rubbing my forehead on a plush street in Bath when I was supposed to be setting up a table at the Bristol Comic Expo. My debut stand at a convention, the next evolutionary stage of comic glory, rather than the usual sauntering the site, lugging a bag chockful of my smutty outpourings, chatting and hoping to flog a comic or two.

The curse was an egg-shaped black rubber ring, which I held in greasy fingers while frowning in abundance. Like an elephant’s trunk suspended on an earring, this was, I’d just discovered, what supported the exhaust pipe of my VW Polo, which now dragged along the road beneath the car. Bit of a design fault, I was eventually informed, fortunately from a ‘mechanic’ passer-by, once the ring bent out of shape, the exhaust dropped.

He eavesdropped my apologies, as I explained the situation to Kev. We talked of my destination, and because of the interest he exhibited, I gifted him a comic, hoping he’d fix the car. I then ventured underneath it, an attempt to assign the ring back onto its bar, and hopefully attach the exhaust pipe; breakdown services for losers! Needless to say, the effort futile. I appeared from under the car to the sound of the mechanic giggling; the guy engrossed in my homemade publication! “No,” he explained the aforementioned design fault. Humm, I see that now. “Thanks for the comic,” he acknowledged, and whistled off on his way.

A wedge of abandoned broken bin held it, not quite long enough to make it to Bristol, but after a few pitstops I arrived, fashionably late. Tense, irritated and in no mood to greet people with plastic smiles and laughs, I spent the day hoofing and sulking. My point to this anecdote, other than I’ve not much of a review to write about Ed Byrne and Friends? When vehicles breakdown on an imperative assignment, nothing is more frustrating. Therefore, to the hundreds sitting uncomplainingly in the Devizes Corn Exchange Wednesday, perhaps it’s best Ed Byrne didn’t make it.

Rescheduled for September, if he had of made it, would he have been on top form, would comical genius spurt from his mouth? Yeah, he’s professional, suppose. Still, I’d favour the feverishly brilliant observational comedy routine, the like we’ve come to expect from Ed would be best served cold. An odds-on at the bookies he’ll open with the tale of his primary attempt to make it to our backwater. Not everyone could conjure an amusing story of being stuck on the M25, I bet Ed could. That’s why these people rule the comedy circuit. See above, I’m capable of writing a comic tale of woe, but I’d never acquire the valour to perform it before an audience; it takes guts and a chunk of lunacy.

comedy1
Chris Stokes Image: Gail Foster

The support acts then, did a grand job. Opening act Chris Stokes vastly different in style to David Hadingham, who followed. Akin to a lovechild of Mickey Flanigan and Bill Hicks, I’d argue David had the posture, the visual comedy, and through crazy expressions could, just, carry off a corny gag. But his style akin to a working-man’s club, was coarse, banal but often hackneyed. References to masturbation and psychedelia pigeonholed him as outrageous, though the quality of the jokes have to match that panache.

For me, David started off brilliantly but declined somewhat, while Chris, more stiff and static to begin with, especially considering he had to break the ice after the devastating blow Ed may not appear, by joking about said devasting blow, grew in wittiness. Through local observations of his bus journey from Chippenham, to a set routine about his Black Country homeland, he improved with each laugh that passed, and importantly, had  incomparable originality. Thick and tough those laughs hailed through the Corn Exchange.

comedy3.jpg
David Hadingham. Image: Gail Foster

No doubt both these guys were remarkably funny, easing the blow dramatically, yet I’d argue Chris was the better of the two, as he played to the mostly, conventional audience. Well done to both for covering the absence of Ed, an unfortunate turn of events. Least, I think, we’d be set for a better performance from him in September than one after a car breakdown.

 

Adverts & All That!

cavifestlegallyblondeheadskittlescarwashsaddlejonsouthgatehauntedpost

 

Vinyl Realm Hosts New Stage at DOCA Street Festival

Yeah, it’s a toasty secret I’ve been busting to spill the beans on for eons; and we’re gathered here today to announce the line-up!

Sometime ago I suggested a local affair for DOCA’s amazing street festival on 26th August, just a small marquee-fashioned area, I imagined, set aside to highlight our local acoustic musicians. Like most of my ideas though, I throw away all practicalities and left it up to a fellow worker to causally whisper it’s a Monday and I’d be working in the morning!

Similarly, though, Pete of Vinyl Realm wanted to do something along these lines, and I’m delighted to announce he has taken the project under his wing and only gone done it, with bells on. The idea has expanded to a full-sized stage, with a great line-up that I’m here today to tell you about.

So, well done to Pete, Loz, et all, who’ve worked tirelessly to sort this out. Next week I’ll be chatting with Loz of DOCA about carnival and the street festival in general, but for now, all eyes on this, set to be the loudest alternative corner of the street festival, ever!

At this point, times of the bands performing are unconfirmed, as it needs to coincide with acts on the main stage. While DOCA’s booking of some fantastic international acts each year, it leaves us eager to know what they’ve in store for August; it’s secret left for you to buy a programme. But do save some room in your wandering for the Vinyl Realm Presents stage at the corner St Johns and Long Street, bang outside the shop.

daydream2

Ah, the new four-piece indie-rock band I’ve been harking on about recently, Daydream Runaways will be playing. Wiltshire-based Ben Heathcote on vocals, Cam Bianchi on Guitar, Nath Heathcote on Bass and drummer, Brad Kinsey. Citing influences from the likes of The Killers, The Strokes and Sam Fender, Airborne, they also praise Fleetwood Mac, The Stones and Talking Heads. We reviewed their excellent single Light the Spark a few months ago, and have high hopes for this youthful bunch.

cracked machine

Whisked away on one awesome, blissful journey through sound after just one listen of their debut album, I, Cosmonaut, Cracked Machine have been mentioned and rightfully praised on Devizine over the last year. Formed in Wiltshire also, in 2015, local space-rock hypnotists, weaving “mesmerising grooves, infectious riffs and layers of sonic texture to create compelling and original soundscapes which take fellow cosmic explorers on an exhilarating trip through the cosmos.” This is Pink Floyd likened space-rock, meeting ambient trance for a new generation, yet their second album, The Call Of The Void, reflects a harder, rock edge, we’re talking Hawkwind here, and it’s reverie style will hold you spellbound.

 

Deemed the headline act, Cracked Machine is a quartet of experienced musicians, brought together in a quest for aural mayhem; Bill Denton on guitar, Clive Noyes on keys samples and vocals, Chris Sutton on bass and Blazej Gradziel on drums. They play the Southgate today, and are a welcome blessing to our local scene.

strangefolk.jpg

Vibrant retro-rock fusion with folk and neo-gothic, Somerset/Hampshire’s Strange Folk UK is one I’ve not heard of, and look forward to. The band’s roots are in folk, and distinct rock aspirations are tempered by a recognisable folk vein running through their songs to varying degrees. Dark impressive vocals ride the crest of a truly great sound that transports the listener to another time.

Quoting their influences may divulge that time; sixties psychedelic legends such as Dylan, Janis Joplin, T-Rex, The Doors, Free, Hendrix, and Jethro Tull, there’s mod influences too like The Who, and Genesis, and harder rock like Zeppelin and Judas Priest.

Between bands, we announce acoustic artists, Devizes singer-songwriters, Marland favourite Tom Littlefair and the brilliant Ben Borrill, topped off with a local funky soul DJ set from Usaf. I’m truly delighted to bring you this news, reckoning this is addition is going to really add a whole new musical dimension to this already fantastic gem on Devizes event calendar. As well as all of DOCA’s exciting circus, street theatre side stalls, rides and games, it now stands at two stages large, double the fun!

benborill

 

Oh, and I do believe Devizine has the exclusive on this one; expect a plagiarising Gazelle or Herod along any moment. Please feel free to share our posts, but if republishing them observe copyright and quote Devizine as the source; basic etiquette, thanks!

 

Adverts and All That Malarkey!

 

artsfestdevaveburyrocksmikjonsouthgatecavifesthauntedpostScooterRallyposterNovskittlesvinylrealm

She Robot Assimilates the British

Images used with kind permission of

Gail Foster.

 

Summer Sunday afternoons in the beer garden of the British; it’s a Devizes thing, a ritual stretching back long before I anchored on these shores. Yet it’s unusual for an android to be found there. In all truth, if any kind of automaton did start socialising on the pub scene, the British Lion would probably be bottom of the list. There’s nothing modern or chic about this favoured watering hole, no ultramodern silver-plated décor, just a good bunch of humans, the odd canine, a happy atmosphere and casks of affordable drinks.

The name of this Devizes Arts Festival free fringe event somewhat misleading, I expected She-Robot to be mysteriously mechanical, and gregariously unresponsive, akin to a robot, even if it was to be that she wasn’t really a robot. I suspected weirdness, machinelike repartee, as the name suggests. Instead, Suzy Condrad is most definitely human, affable, humoured and inspired, wearing her heart on her sleeve regarding her art, and modest with her talent.

sherobot2

Queen of the Boss loop station, this multi-instrumentalist, one-woman band interlaces, effects and autoharp, glockenspiel, thumb piano and random objects to produce a unique sound, reflecting synth-pop and electro of yore, yet with a twist of contemporary ambient house like a strong bassline, and perhaps most poignant, her echoing voice and beatboxing.

She Robots hails from Bristol, her loose, avant-garde repertories remind me of Portishead, least the Bristol techno downtempo scene, to an extent, yet it’s more inimitable and individual. Captivating the audience to silence as she glides through her own compositions, and discretely reassigned covers like Kate Bush’s Running up that Hill, and one I virtually missed the source of through her own take, KRS-1’s Sound of the Police.

So yep, there’s something unquestionably electro-80s about Suzy, archiving influences I suspect from Depeche Mode, Joy Division and Yazoo, to perhaps the Art of Noise. Yet, here’s the thing, the style, the namesake gave me this preconception it’d be Kraftwerk-stiff and structured, Art of Nose secretive, but the sound flowed stunningly, ambiently and she spoke with poise and ease during prolonged breaks as she aligned her technology and instruments to perfection; far more down-to-earth than your typical robot.

sherobot3

She jested, with accounts of previous gigs, such as excusing malfunctions in her loop-pedal as mud from a festival, or recounting an amusing episode gigging in Camden where the sound of an ambulance siren got caught in the loop-pedal. See, robots don’t do that, they cannot articulate socially, joke and frantically dance like a raver, with all the joy of presenting her music unto us, and that, was the most appealing part of She-Robot’s show.

So, I could argue her one-woman-band was not the master of a particular instrument, more so, the skill is the precise timing, using that loop-pedal like an instrument all of its own. I pondered what atrocity of unorganised clamour I’d create given half a turn on the thing! Yet to turn away, you’d be forgiven for thinking there was a full band up there.

Aptly, and prior to her encore, Suzy finished on Blue Monday, pure and effective nod to her principle influences, and doubtlessly as it’s an irresistible foot-tapper. But along with her genial charisma, and immense skill, it was the individuality which allured me, and her use of the ukulele, in particular, to bless the otherwise electro-synth pop sound with a reggae skank; trust me to pick up on that!

If I was informed in the past, the free fringe events of Devizes Arts Festival often failed to attract attention, it was not the case here. I hope I’m getting through those who may wear this out-of-date typecast of what the Arts Festival is about, because let’s not name and shame, I’ll admit I was once like you, but now I’ve seen the light.

 

Adverts & All That!

ericerniemikskittlesaveburyrocksdedicoatjonsouthgateonceupontimehauntedpostsaddle

REVIEW – Devizes Arts Festival – Moscow Drug Club – 7th June @ Exchange Night Club, Devizes

Drugs Down In The Bin!

By Andy Fawthrop

 

Well, sort of. Bear with me. In fact this was yet another Devizes Arts Festival offering that turned out to be an absolute cracker of a gig.

Descending into The Corny Bin, or The Exchange Night Club to be precise, I wondered why this particular venue had been chosen for this particular gig. But as soon as I got in there, it was flippin’ obvious. The place had been set out with plenty of tables and chairs, the lights had been set to low and sleazy, and the crowd packed into every last place had created exactly the right ambience. We were in a real nightclub – old school! As Katya, lead singer of the band, remarked immediately she came on stage: ‘wow! This place is for us! This is where we should live!’ Indeed.

drugclub

Moscow Drug Club describe themselves as “transcendent troubadours of gypsy cabaret and swing” and that’s exactly what we got. Material ranged from their own self-penned compositions, a couple from Eartha Kitt, via way of Louis Armstrong, Jacques Brel’s “The Port Of Amsterdam”, Charles Aznavour and Tom Waits. And, was that a nod towards Django Reinhard? Leonard Cohen?
Each number took us a different musical place, a different atmosphere – Berlin cabaret, Hot Club de France, old Tangiers, eastern Europe. But it was always dark, earthy, sweaty, smoky. We were in the 30s, now the 40s, now the 50s. We were listening to blues, to jazz, to gypsy swing rhythms.
It was a heady and intoxicating mixture, delivered with some style. Canadian Katya Gorrie led from the front with some cool, dark, sleazy vocals, ably assisted by her splendid 5-piece band. Stand-out performer for me was Jonny Bruce on trumpet, who belted out some astonishing solos, as well as filling in the rhythm with some spicy interjections. And I cannot remember the last time I actually heard a double bass solo (delivered with aplomb by Andy Crowdy) and where an entire room of drinkers was reduced to awe-inspired silence.

drugclub2

The whole concert was fantastic, delivered with style, humour, great musicianship and plenty of warmly-felt audience engagement. For me this was a superb all-round performance – I gave it 5 out of 5, and my companion (who is notoriously difficult to please) declared it to be the best gig I’d ever taken her to! The crowd absolutely lapped it up, and the fully-deserved encore featured the song that began it all for the band:
“Moscow Drug Club – it’s a secret rendezvous!

Moscow Drug Club – where the Reds play the Blues!”

If you’d like to see and hear more of Moscow Drug Club, head over to their website at http://moscowdrugclub.com/ which includes a list of their future gigs for the rest of the year.

So – well done (yet again) to DAF for booking this wonderfully bonkers band, and bringing them to our town!

Don’t forget there’s plenty more music and other stuff before the Festival finishes on 16th June. If you haven’t done so yet, get yourself a ticket and get along to see something!

 

Adverts & All That!

vinylrealmericernieaveburyrocksmikdedicoatjonsouthgateskittleshauntedpostonceupontimeartsfestdev

Billy Green 3; Should not be Moved

On my holibobs last week, local Geordie Britpop/mod musician Bill Green of trio Billy Green 3, (not to be confused with the British-Upper Canadian scout who saw victory at the Battle of Stoney Creek, naturally) messaged a YouTube link to his debut single, “I Should be Moved.” Promised to get on it this week, finally made it; procrastination rules, but glad I did.

Impartial towards Britpop, it’s not Marmite, I take it or leave it. In my defence, during the era rave was the thing, Madchester just a slice and not a principally progressive slice when compared with breakbeat. To shock horror of Oasis fans, I sauntered past them on the NME Stage at Glasto 94; never heard of them, never cared to; I was hunting hi-tech party vibes, not a Beatles tribute.

I try to decipher if my appreciation of the genre has matured, or if it’s the forceful sixties-mod element which, while present in Britpop generally, seems particularly prominent in Billy Green 3’s style. The words and riff echo a Britpop classic for catchiness, studio noise and tambourine intro and, especially, the chorus though, rings the simplicity of sixties mod. With the modern component of a perfectly placed sample, the circle is complete, Samuel L Jackson’s one-liner as Pulp Fiction’s Jules Winnfield completes it. “Sounds great, Bill,” I replied after a tinny listen on my phone’s speaker, because it does. Grown on me more, now I’ve got it on loud.

If anything, the magnitude of this slick three-minute ride spurs me bookmark Billy Green’s next local gig, though none listed yet; watch this space. Meanwhile I wanted to gage Billy about what the recording side equates to. “I assume it’s an original song,” I asked, “written by you?” and fired several other minor questions all at once, at least England was one-nil up…. at that point.

“First recording with the new project, me and a young lad called Harvey Schorah on drums, backing Vox and all-round vibes,” Bill replied. “I wrote the words and music, played guitar, bass and sang lead and backing vocals. Martin Spencer [The Badger Set, Potterne] produced. He’s a magician, essentially, he took the song in my head and made it come out of the speakers; just love this creative process in addition to the recent live shows.”

On what this will spur, Billy explained, “second song in mixing as we speak, and then hopefully will work out how to put them out as a mini EP.” Posted on their Facebook page today, we may get a listen to it, Lose Our Way, at 7pm.

Drafting my next question, for the review lead us onto football, I mouthed my thoughts that England are sitting back on a 1-0 and then, oh dear (or words to that effect!)

billygreen31

“Brilliant,” Billy added, “the review, not the football, they were poor on the first half apart from the penalty, still time though; being a Newcastle fan sometimes optimism is all you have!”

This fell appropriately onto my last question; does Bill think Newcastle had a scene during the Britpop era to rival Manchester?

“Prior to Britpop I think,” He suggested, “later 80s, there was a label called Woosh, my mate’s band, the Nivens were on there and ran on Flexi discs. There’s a retrospective out called C87 which was named after the NMEs C86, but a couple of decades later, they’re on there, so jangly guitar pop; the Nivens actually opened for the Smiths. Club nights at the Broken Doll and the Riverside, basically was my musical apprenticeship, introduced me to so many great bands. Moving into the 90s, there was more of a grunge scene with Cranes etc, now there is a resurgent drone scene with a hotel in Byker putting on Japanese noise artists, it’s a bit bonkers.”

“Bonkers could describe any current pop scene in the UK though,” I scoffed.

“Fair point,” Bill nodded, “Alan McGee doing his bit for guitar bands with the Creation23 label, and This Feeling are putting on some good nights. I work in London a bit, so have been to a few of their club nights. Met up with the now defunct the Shimmer Band from Bristol, who I thought were destined for great things. DMAs came out of that scene, from Australia, and are now heading festivals, think Shame came up through there, my mate’s band Free Money are booked in, they even did the last Lexus ad, which is a bit mad. I guess I’ll always be a fan of the get a group of mates together and play in a garage until someone notices you route.”

Well, that’s been the ethos for many a decade and never did the garage scene of the sixties any harm. Stuff the Simon Cowell karaoke TV show fiasco, Billy Green 3 is archaic in fashion, just enough to know the score, yet fledgling to fit into the burgeoning music scene here; I think “I Should be Moved,” puts a stamp on that; take a listen and decide for yourself.

 

Adverts & All That!

queenspartyquizconsartsfestdevwelbeingjonsouthgatemikericerniededicoatskittlesaveburyrocksonceupontimehauntedpost

Legally Blonde Jnr Comes to Devizes

You got into Harvard Law?

What? Like, it’s hard?

Hey, get your flaxen Barnett around this; Legally Blonde, rom-com, chick-flick adaptation of Amanda Brown’s novel of the same name is eighteen years old. Yeah, like, I know right. Two years later they made the sequel; although a smash at the box office, it never raised a reviewer’s eyebrow, banally crashing the blonde versus brunette joke which Archie Comics carried for over seventy years.

Yet the initial movie stands the test of time, I like it and chick-flick generally isn’t my thing; lack of spaceships blowing things up, see?! The foreseeable gags enhanced by Reese Witherspoon’s amusing characteristics, at a time when The Spice Girls’ run of “girl power” was fading. Challenging the blonde stereotype with comical narrative was a peg in female equality and certainly the break for Reese; ummm, Reese Witherspoon…… where was I? Oh yes, female equality.

legallyblondehead

Like many trailblazing films, it received a theatrical reworking by 2007. Premiered on Broadway, Legally Blonde had an efficacious three-year-run at London’s Savoy and picked up many awards. Now, directed by Oliver Phipps and Hayley Baxter with musical direction from Naomi Ibbetson, it has found its way, least a “Jnr” version, to our own Wharf Theatre.

Legally Blonde Jr. The Musical opens at the Wharf Wednesday 24th July, runs until Saturday 27th (7.30pm each evening with a 2.30pm Saturday Matinee) and promises to be pink: “The Musical is a fun and sassy journey of self-empowerment and expanding horizons, with instantly recognizable songs, this show will leave cast members and audiences alike seeing pink!”

Plot being, if the film passed you by: The Delta Nu sorority president, Elle Woods, seems to have it all; good looks, a relationship with the campus catch and a great taste in clothes. However, her life is turned upside down when her boyfriend, Warner, dumps her to attend Harvard Law School. Determined not to lose him Elle uses hard work and a fair degree of charm to get a place there herself so that she can prove she is serious and win him back. Whilst there she tackles stereotypes, snobbery and scandal but she also makes some great new friends along the way and gradually discovers how her new found knowledge of the law can really help others.

With music and lyrics by Laurence O’Keefe and Nell Benjamin, again it’s a rousing and prevalent choice for the delightfully quaint Wharf Theatre. Tickets, £12 with under 16s £10, can be purchased from Ticketsource, at the Devizes Community Hub and Library on Sheep Street, or by ringing 03336 663 366. To find out what else is on at the Wharf pick up a Spring/Summer brochure which is available from the Community Hub and Library and many other outlets around Devizes.

 

Adverts & All That!

ericernieartsfestdev

queenspartyquizconscarwashwelbeingskittlesaveburyrocksjonsouthgatemikdedicoatonceupontimehauntedpost

REVIEW – Devizes Arts Festival – String Sisters –5th June @ St Andrew’s Church, Devizes

A Cracking Little Concert

By Andy Fawthrop

 

There’s so much to do and see in this year’s Devizes Arts Festival that it’s hard to pick out the best bits. From what I’ve already seen and heard, this year’s event is turning out to be another cracker, and there’s plenty still to go.

Today, for a bit of a change, I decided to go to church. No – I’ve not suddenly seen the light. I decided to go and see String Sisters in a lunchtime concert at St Andrew’s church in Long Street. The place wasn’t quite full. But not far off. And it turned out to be a good way to spend a lunchtime.

string3

Angharad and Lowri Thomas (can you tell that they are from that there Welsh Wales??) are sisters who play the violin and the viola respectively. They also play those instruments darned well. We were treated to a whole range of pieces from classical (Vivaldi, Bach) to modern (Can’t Help Falling In Love, Delilah) to tunes from the musicals (America from West Side Story, I Could Have Danced All Night from The King and I) and all beautifully wrapped up in some charming and funny anecdotes. These sisters not only knew how to play, but how to engage with the audience and therefore how to entertain.

string2

The concert was only an hour long (I could have listened all afternoon), but it was packed with goodies, and thoroughly entertaining – a little cracker of a concert.

Well done to DAF for finding String Sisters and bringing them to our town!

Don’t forget there’s plenty more music and other stuff before the Festival finishes on 16th June. If you haven’t done so yet, get yourself a ticket and get along to see something!

 

Adverts & All That!

queenspartywelbeingaveburyrocksericerniejonsouthgatemikdedicoatonceupontime

Our Cheque to OpenDoors

Hey there, just a quick one from me today, mind, I say that then I start waffling, you know how it is!

 
Delighted to announce that I handed a cheque for the total sum of £225 to Devizes Opendoors today, from our fundraising events at the Bear Hotel’s Cellar Bar in Devizes last month.

opendoorpng

It was good to see the homeless charity still thriving, offering takeaway food after their cooked breakfast. Books and clothes are also available to takers; people in sheltered accommodation or sleeping rough in our neighbourhood. It has been over a year since I paid them a visit to highlight the good work they do, see the article here. It was great to know the followers of Devizine has contributed, even just this small amount to this often-overlooked charity.

 
With Devizes Opendoors saddened by the recent passing of one of their regular guests, Richard Manning early in May, the organisation could do some better news. They’ve raised funds from their recent Quiz Night, and The Sing Alive Choir’s event on the 11th May. You can find out from their exhibit at Devizes Health and Wellbeing event, and from the website, here.

welbeing

It was even better to acknowledge that we had fun doing it! Reminders of our two events can be read here, and here. Again, a massive thanks for all who attended, to Luke and the Cellar Bar staff for putting up with us. To Harvey and Finely Trusler of the lively Truzzy Boys, Jordan Whatley aka The Hound on the Mountain for that fantastic and expressive set, Gail Foster for brill photographs which just seem to get better with every snap, and her witty and poignant poetry interludes, and the gents of those brilliant Roughcut Rebels; Jamie Elly, Doug Wilcox, Mark Slade, and John Burns.

 
Of course, that was just the first night, an assortment of live music. For our second, all-reggae night the following Saturday we have Nick Newman, aka Razah, and Knati P, aka Clifton Powell to massively thank. Alongside their dedicated team who carried the equipment down those wonky steps to build the loudest sound system the Cellar Bar has ever witnessed, and stayed to party with us! Particularly Sam Chaloner for assisting the door and encouraging punters to come party.

queensparty

 
What comes next? Thanks for asking, but I’ve no idea. I’d like to get summer over and done with, so full of great events already. Then I’d like to do some more Devizine Presents gigs, using our many venues in town and highlighting the best of our local talent. There are many other charities I’d like to include and so, watch this space until the leaves fall from the trees (let’s not think about that yet though, eh?!)

 

Adverts & All That!

ericerniemikaveburyrocksdedicoatjonsouthgatesaddleonceupontimehauntedpost

PREVIEW – White Horse Opera sing Gilbert & Sullivan’s “The Mikado” – Saturday 15th June @ St Mary’s Church, Devizes

A Bit of Nanki-Poo in The Vize

By Andy Fawthrop

 

Do you like opera? What about “light” opera? With rather a lot of comedy thrown in? Good – because you’re really going to love this!

Last night I was privileged to attend the full dress rehearsal for “The Mikado” by the splendid White Horse Opera company. I was expecting something perhaps still a little rough round the edges, maybe the odd fluffed line, the occasional note or cue to be missed, but there was really none of that. The company had been rehearsing for months, had chosen their principals carefully, and were absolutely up for it.

Yet again – another gem in the entertainment crown of Devizes – we are so lucky to have these people doing this stuff!

mik3

This particular bit of nonsense, a “comic opera” in two acts, with music by Arthur Sullivan and words by W.S. Gilbert, their ninth of fourteen operatic collaboration, opened in March 1885, in London, where it ran at the Savoy Theatre for 672 performances, the second-longest run for any work of musical theatre, and one of the longest runs of any theatre piece up to that time. Since then it’s been translated into numerous languages, and is one of the most frequently played musical theatre pieces in history. The setting is Japan, an exotic locale far away from Britain, which allowed Gilbert to satirise British politics and institutions more freely by disguising them as Japanese. And the company has done an excellent job of the now-traditional exercise in updating the lyrics of some songs to reflect politics Britain in 2019. Particularly pointed was Ko-Ko’s (The Lord High Executioner’s) song about who he’d like to execute (“I’ve got a little list, and they’ll none of them be missed”).

mik1

It’s always difficult, and sometimes a little invidious, to pick out individual performances but I think it’s worth mentioning particularly Graham Billing, who delivered a hilariously nervous and dithering Ko-Ko, Charles Leeming as a wonderfully pompous and self-important Pooh-Bar (Lord High Everything Else), Lisa House as Yum-Yum, and the resilient Ian Diddams, playing The Mikado splendidly as a power-crazed modern dictator. But there were strong performances all round, from every member of the cast. It was so obvious that they were thoroughly enjoying what they do, delivering a top-notch production.

I’m not going to give the plot away, nor would I even attempt to summarise the complicated ins and outs leading to the hilarious denouement – suffice to say that the story is stuffed with disguises, mistaken identities, the fickleness of emotions, and the usual human drivers of fear and greed. The main characters ham it up splendidly, and deliver the songs with confidence and panache, squeezing every last drop of comedy out of the script.

mik2

Given that it’s performed in modern dress, sung in English, and is a laugh-a-minute, it’s completely accessible and enjoyable. So, even if you thought that you didn’t like “opera”, I can assure you that you are going to love this. Thoroughly entertaining stuff!

It’s going to be performed on Saturday 15th June at St Mary’s church at 7.30pm. Tickets are an absolute bargain at only a tenner, and are available via Ticketsource or the company’s website at
https://whitehorseopera.co.uk/

mik

Future productions by WHO include:

• Wednesday 30th Oct to Saturday 2nd November @ Lavington School – Bizet’s “Carmen”
• Tuesday 17th December – venue TBA – Christmas Concert
• Friday 20th March 2020 – venue TBA – Spring Concert

And if you’re interested in getting involved yourself, whether singing, playing or behind the scenes, just head over to their website. You can also support them by becoming a “Friend” of the company for £20 p.a. Remember – they are an amateur company, supported by volunteer efforts and by voluntary contributions from their supporters.

 

Adverts & All That Malarkey!

artsfestdevqueenspartyericerniededicoataveburyrockswelbeingsaddlequizcons0941596001555518913_all stars flyerjonsouthgateScooterRallyposterNovhauntedpostonceupontimevinylrealm

Reggae, Reggae, Reggae, in…. Devizes Arts Festival?! Barbdwire Bring a Taste of Coventry to Town

All Photos used with kind permission of Gail Foster

 

feat2

From a talk by CBE award-winning English foreign correspondent and BBC News world affairs editor, John Simpson, to the Sub-Organist at Durham Cathedral, Francesca Massey, the Devizes Arts Festival has kicked off this week, better than Tottenham. Their showcase, more varied than ever before, truly caters for all; you just need to either research, or hear me bashing on to find something suitable for you.

Personally, my time came Saturday, when the Corn Exchange was blessed with sweet, sweet reggae music! You know I love thee, local music scene, but my ongoing quest to encourage more reggae in these backwaters came to an apex last night.

5

Perhaps a hard sell in Devizes, yet a genre I’ll push until the wheels fall off. Yep, said wheels won’t last to shove Devizes into the streets of downtown Kingston Jamaica, but our great hall was lively and the modest audience appreciative of what Coventry based Barbdwire delivered.

Without doubt Barbdwire could produce a “beginners guide to reggae,” without watering down or succumbing to commercialisation. For all sub-genres were presented to us last night, with tremendous panache and sublime competence.

4

I often wonder how irritated Ziggy Marley gets when interviews adopt the cliché angle of his father, recollecting him once stating, “reggae is not a one-man-music, it’s a people music.” An apt quote for Barbdwire, the band a varied bunch. While originator and drummer, Trevor Evans, the former Specials roadie-once drummer, characteristically oozes a reggae archetypal, bassist Chelly’s persona rings out dub and the proficient trombonist has Two-Tone band written all over him, trumpeter John Pudge, clearly the youngest, doesn’t appear represent any reggae stereotype.

feat

I snatched a quick tête-à-tête with John, attired in a T-shirt embossed with “Roots, Rock, Reggae,” I was keen on querying his t-shirt gainsays against his instrument choice, brass sections being generally considered ska-related. We discussed how Barbdwire play to the audience; their ability to pull any of reggae’s subgenres out of their hat makes the band flexible, supporting The Specials, as their next gig, or Holli Cook, as they did last week.

3

But centre of attention last night in Devizes, this band were an epiphany for some residents and a universal accreditation for those reggae lovers. In our preview I said, “(Two-Tone) may have challenged punk with chicness akin to mod, but today, these subcultures are inconsequential, we can bundle it all into one retrospective burlesque, select whatever element of any we care to, and fuse them without pretence or offense; one reason why a group like Barb’d Wire is fresh and electrifying.”

 

Well, while reproducing their album Time Has Come’s originals did just that, their choice of covers was equally extensive. From ska favourites like Baba Brook’s version of Herbie Hancock’s Watermelon Man and the Wailer’s debut hit Simmer Down, they also exposed the audience to roots, with Max Romeo’s Chase the Devil, Horace Andy’s Skylarking, renowned for his later work with Massive Attack, and even dub, akin to its master King Tubby.

2

There were versions of reggae classics, like Uptown Top Ranking, and all harmonised by the beautifully melodic and confident vocals of Cherelle Harding, a singer who could roll on a lovers tune with the finesse of Phillis Dillon to convert without haste to toast a stepper’s riddim, at one point verging on dancehall with a wonderfully luminous interpretation of Sister Nancy’s Bam-Bam.

Make no mistake, this diversity was not delivered reggae-lite, rather an expertise and rounded acknowledgement to the many faces of Jamaica’s music export, and delivered to us adhering to all the positivity and joyfulness the genre celebrates. As an apt example, they gathered outside to meet and greet, where they were applauded with respect vowed to add our town to their tour map; something I’ll hold against them, as this was an outstanding performance!

6

Long live the Devizes Arts Festival then, hopeful they’ll consider the evening a success and plan in, as they are already planning 2020, something else reggae-related. Following on, this week sees Strange Face at The Bear today (Sunday) where the Adventures with a Lost Nick Drake Recording takes place.

Monday and Christian Garrick & John Etheridge presents Strings on Fire at The Exchange. Tuesday is The Shakespeare Smackdown, and Wednesday String Sisters are at St Andrews Church.

An Audience with Bob Flowerdew at the Town Hall, also Wednesday, and Thursday, Atila Sings the Nat King Cole Story at the Town Hall. Oh, and next Saturday has a whole host of FREE fringe events across town. Check the website for booking details, but hurry, Friday’s Moscow Drug Club event is sold out. If cancelations occur find posts on the Arts Festival Facebook page, and I’ll promise to share them as soon as I spot them; have a great festival!

You Can Help Liam?

Liam is the most caring and loving boy that unfortunately cannot live a life of his dreams.

 
He nearly lost his life three days after his birth when he suffered Hypoglycaemia and associated brain injury. Liam was treated for severe sepsis and as a result of this trauma he now suffers from multi-focal epilepsy, global developmental delay and is also visually impaired. He has difficulty communicating and moving about safely, therefore he has special educational needs.

 
Now 6 years old, none of the medications he’s prescribed for his epilepsy have helped him in any way, they make him feel nauseous, restless and agitated. Even with four years of continual medical review and dosage titration there has been no improvement in Liam’s health.

 
Recently his family discovered there may be another hope for Liam. they found a medical doctor in Egypt that specializes in healing brain injuries by combining medical and holistic approaches. She’s had many successes in the past 35 years helping children with epilepsy and other neurological conditions, who similarly, had no other options left.

 
Liam’s family would like to raise money to take Liam to Egypt to undergo this treatment. The treatment involves daily visits to surgery, injecting supplements, adjusting diet and lifestyle advice that will attempt to regenerate Liam’s brain and hopefully help him to live a more fulfilling life.

 
Liam’s mum from Devizes, Martina Pangrazzi is a single mother with two other children, the cost of the treatment and taking time away from work while having the means to care for her other two children while she is away is overwhelming.

 
Can we get their campaign to required £7,000? Can you help Liam? Give what you can here.

 
Martina would greatly appreciate any help; it will make a huge difference to Liam’s life. In her work, Martina helps people overcome their anxieties, depression and stress, but unfortunately, she cannot help her son, and needs your help. “This seems to be the only option we have,” she said.

 

Adverts & All That!

Barbdwirededicoatqueenspartyaveburyrocksjonsouthgatewelbeingericernieonceupontime

The Band Plays On: Kossoff @ Long Street Blues Club

At Last – I’m All Right Now…..

 By Andy Fawthrop

 

I’d been waiting for this gig for quite a while. Bearing in mind my general antipathy towards “tribute” bands, I was feeling both excited and apprehensive. Being of, let’s say, “a certain age”, Free (and later Bad Company) had been my go-to rock bands whilst I was still learning how to grow facial hair, and what girls were for. Just hoping they weren’t going to spoil my memories….

The late Paul Kossoff, erstwhile guitar genius behind that 60s/ 70s band Free, was the inspiration behind tonight’s particular line-up. It’s now over forty years since Koss, one of Britain’s finest guitarists tragically passed away at the tender age of only 25 in 1976. The break-up of Free had been, in part, due to Paul’s ongoing battle with drugs. Only when Paul Rodgers and Simon Kirke had gone off to the US to form the highly-successful Bad Company, did Paul come to his senses enough to form his short-lived band Back Street Crawler.

Terry Slesser – the voice of that critically acclaimed band, and a close friend of Koss, is now keeping alive the memory and the music of one of the greatest British Blues guitarists. Sless chose the guitarist John Buckton, of whom Simon Kirke said “If Free were to reform, John would be my first choice as guitarist ” to play this series of special dates reviving for the first time since the 70s the catalogue of Back Street Crawler songs, as well as favourite Free numbers.

And a packed Long Street Blues Club was very much the beneficiary. The night was opened with great local support act Jamie R Hawkins (sounding superb with such a great sound system at his disposal, and doing his third gig of the day!). Then two fabulous sets from the main band.

koss1

The big advantage here was that Sless was actually a friend of Koss, and played with him back in the day, so the sets were liberally interspersed with genuine stories and anecdotes. This immediately lifted us out of the “tribute band” category, and into the realm of genuine homage. The focus was very much on early, rather than late, Free material. Whilst there was certainly time and space for such later classics as All Right Now (how could there not be??), Wishing Well and My Brother Jake, the emphasis was very much on the earlier more bluesy material with which Free originally gained their massive following. It was a real treat to hear I’m A Mover, Woman, Songs of Yesterday, I’ll Be Creeping and the stunning encore (as Free themselves used to do) of The Hunter.

 

All of this delivered with confidence and panache. But no room for anything over-polished – it was all down and dirty, reproducing that thick, squidgy bass sound, wandering round every number like a prowling wild-cat, superb screaming guitar solos and some spot-on vocals – a fruity, solid noise. Could have been in the room and all that. Nostalgia certainly – been good if Sless hadn’t kept mentioning “50 years ago” thanks very much! – but this material stood up to the test of time with some ease. Somehow the band managed to reproduce the sound of Free and Back Street Crawler with some accuracy, whilst still delivering it all in a fresh and full-on way.

koss2

It goes without saying that they brought the house down. Ian Hopkins mentioned in his introduction that the band had been one of the more expensive he’d managed to bring to Devizes, but from this punter anyway it was a solid thumbs-up – definitely worth it! Off home happy and heading for the Free CDs on the shelf!

Another great night at Long Street Blues Club and looking forward to the next season already.

 

Adverts & All That!

Barbdwirequeenspartyericernieaveburyrocksmikwelbeingdedicoatjonsouthgate0941596001555518913_all stars flyerhauntedpostScooterRallyposterNovonceupontimevinylrealm

Back on the Saddle!

Tipsy suggestions to those Saddlebackers at their gurt lush day festival at Devizes Sports Ground were poo-pooed from the off! With this year’s line up rolling out across social media, it’s easy to see they took my expansive notions as nonsensical dribble. A dance tent; yeah, right, circus and performing arts acts; get outta town, even a reggae stage is not to be. Feasibly, they know what they like!

With seemingly no plans to overinflate or cater for revellers outside their chosen target audience, this year’s Saddleback Festival drives surely on quality not quantity, and if good ol’ rock and blues music is what you want, and face it, it’s the most desirable around these backwaters, then it looks like Saddleback return to deliver.

saddle.png

Deliver they intend to, on 20th July, at a busy time with The Full Tone Orchestra promising a free event on the Green and Melksham’s Party in the Park on the same date, Devizes Carnival, Trowbridge’s Once Upon a Time in West Fest and the Swindon Shuffle the weekend prior, the Beer Festival and Devizes’ first scooter rally at the beginning of the month, perhaps it’s a reasonable move for Saddleback to stick with the working formula of previous years.

No extra acoustic stage for local acts has been announced, like the “bolt-on” last year. While being just that, it was at least a presence for them. It’s all focus on who’s performing main stage then, and tribute acts seem to feature predominantly. The longest running, full-time professional tribute to Led Zeppelin, Whole Lotta Led headline; and we all like a lotta Led.

Significant changes to their original line-up from 1996, six years ago, has seen considerable progress with the Whole Lotta Led’s customary two- and half-hour shows, receiving international acclamation from Zeppelin fans. With over 1,300 shows under the belts, they’ve performed Stairway to Heaven more than any other band in the world, interestingly, including Led Zeppelin!

To truly dedicated fans who witnessed the real McCoy at their prime, Whole Lotta Led avoid wigs, costumes, and look-alike paraphernalia to focus on recreating the music to an astonishing level of accuracy. They’ve recreated some of Led Zeppelin’s legendary live shows; 2001 they performed the ‘Bath Festival’ set, in 2003 staged the ‘Earl’s Court’ tour, in 2005 they recreated Zep’s last shows in England with the ‘Knebworth’ set, performed the live CD ‘How The West Was Won’ in 2006 and in 2008 they completed the ‘2007 O2 Reunion Show’ tour.

In a similar fashion, Creedence Clearwater Review are the UK’s premier tribute to Creedence Clearwater Revival, capturing the feel, sound and atmosphere of the short-lived late sixties American band. With audience involvement, singalongs and plenty of rousing choruses the Review promise an authentic and power packed tribute to the Creedence legacy, sticking as closely to the album tracks as possible. There’s also a nod to John Fogerty’s solo career in the show.

To concentrate on original acts, most are Bristol-based, like Elles Bailey is that wonderful hard-blues chick we’ve covered on Devizine before. With a prolific and authentic blend of country and blues, Elles is the UK dynamite on the scene.

The second name to continually popup locally is Ruzz Evans, who since 2014, with drummer Mike Hoddinott and Joe Allen on upright bass make up Ruzz’s Guitar Blues Revue. The trio house a powerful, soul-injected mesh of Blues, R’n’B and Rock’n’Roll of retrospective energy. The opportunities to open for some class acts, from Rockabilly’s the Delta Bombers and the Rhythm Shakers from Vegas to Dr Feelgood and The Blockheads. Plus, the newly released studio album, Burn Out, which features Pete Gage from Dr Feelgood’s band, certainly shows enthusiasm, skill and passion; this one is going to get lively.

 

Also booked is four-piece blues/funk outfit, The Will Edmunds Band, who perform interpretations of classics from the likes of Robert Johnson, BB King, Albert King and The Meters. Their sound promises to be tight and fresh, yet retaining old-school mojo!

And that’s what we’ve been told so far. No mention of Jon Amor; surely, he’ll drop in, would’ve thought? Ah, one step ahead of you. The Friday before , 19th July, he’s at the pre-festival event at the Sports Club, where for a tenner you’ll get Saddleback favourites Innes Sibun and Jon, with Mike Hoddinott of Ruzz’s Guitar Blues Revue and what’s worth the entire weekend price-tag in my humble opinion, for all it’s worth, the awesome UK-USA blues conglomerate, Beaux Gris Gris who we’ve reviewed a night of before.

saddlebackfri

A further tenner means you can camp for the weekend, from 5.00pm Friday 19th July, with campers asked to leave the site by 10.30am on Sunday 21st July. It may be whacking the total from £25, for a main ticket, to £45 for the whole shebang, and in all honesty the mods may have it cheaper than the rockers this year, the Scooter Rally tallying to £25 for the whole weekend with free camping, but a considerable donation of Saddleback is off to chosen charities Julia’s House and Care If, and going on the sturdy and reliable security, strategic setup and organisation that went into last year’s event, together with an awesome line-up, Saddleback will not go unnoticed, even if promotion of it seems somewhat lessened this year.

 

Here’s last year’s snaps to get you in the mood; all images by Nick Padmore

Adverts & All That!

 

vinylrealmBarbdwirewelbeingqueensparty0941596001555518913_all stars flyeraveburyrocksericerniemikdedicoatScooterRallyposterNovonceupontimehauntedpost

You Can’t See the Join; Eric & Little Ern at Devizes Arts Festival

Youngsters may ponder how we survived times of yore with just the three TV channels. Certainly, children’s shows stopped at six, new-fangled video recorders were expensive commodities and presented their users with a horrendous relay, poor sound quality and the tedious labour of rewinding. Yet we had something which barely exists today, an eminence of shows designed to entertain a family; can you think of similar today?

Variety performances outclassed anything you might deem akin today. Simon’s Cowell’s amateur talent contest TV shows remained firmly in the holiday camps, professionals reigned weekend viewers which style and panache. Contemplating it, The Simpsons is perhaps the only show the entire family enjoys, as while I’ll watch Britain’s Got Talent, one eye squints.

Ant and Dec are no replacement for The Two Ronnies, arguably the only duo to come close to the sovereigns of weekend family entertainment, Morecombe and Wise. If you never thought you ever see anything like their magic again, think again.

eric

Ian Ashpitel & Jonty Stephens are Eric & Little Ern, a remarkably accurate tribute that has to be seen to be believed. Spotted the posters of their Devizes Arts Festival’s event on 14th June I thought “yeah, right.” But no still image can summarise the precision of “An Evening of Eric & Ern,” you have to check these videos out.

Away from my theories, do Ian and Jonty think Morecambe & Wise are still popular today?

“We have been asked, many times, over the years what is the lasting appeal of Morecambe and Wise?” says Ian Ashpitel who plays Ernie “I think that it’s a combination of many things; they grew up with each other and had an instinctive timing that is hard to replicate. They were friends first and foremost, closer than brothers. They grew up learning their craft together. Making mistakes together, finding what works and doesn’t work as they played clubs and theatres for over 20 years before being seen on TV for the first time. They were likeable and people could relate to them, to their sense of humour and their comedy. Working class gentlemen as someone once told us. Eric was one of the finest comics Britain has ever seen and, with the perfect comedy foil at his side, it was a truly magical combination. Having played Ernie, it’s made me realise just how good he was. His timing was immaculate and they had a trust in each other that flowed effortlessly through their performance.”

“Exactly” says Jonty, “They were so relaxed together on stage, so funny, that everyone felt safe in their company. They were brilliant because they appealed to everybody, all walks of life, men-women, young-old, everybody found them funny and it’s very hard to do.”

Their catchphrases now engraved in our language, the songs and gags will never fade with time. So, in their show, it’s Ian and Jonty’s aim to replicate Morecambe & Wise’s live theatre shows, with the famous songs and sketches from their TV moments, as well as a few surprises and a guest singer.

 
Ian and Jonty first met at drama school in Birmingham in 1983 where they became firm friends. Even back then people would ask ‘are you a double act?’ to which the boys would answer, in unison, ‘No.’ Jonty is a brilliant mimic; Eric was one of many impressions he would perform from an early age. He’s a self-confessed Morecambe & Wise anorak and it was his knowledge and love which proved to be the bedrock of their story.

 

Now jobbing actors and members of The Stage Golfing Society, in 2002 Ian and Jonty would put on a review/show. They performed a five-minute sketch and were instantly told ‘you must do something with this’. It has to be said by now nature had taken its course with Jonty’s hair and Ian had fully developed the short fat hairy legs!

 

ericernie

 

During the run of the initial show, which had moved from Richmond to the Edinburgh Festival, Eric’s son Gary Morecambe saw the show and loved it. Support and approval from the family were massively important to Ian and Jonty and continues to be so. The show then went on a hugely successful tour, which culminated in its first West End run in the Christmas of 2013 at the Vaudeville Theatre.

 

The show was nominated for an Olivier Award in 2014. Another tour and a Christmas run at the St James Theatre London followed. Devizes has a grand chance to witness it from the comfort of their own town, one of many highlights of our Arts Festival. Tickets are £21 here.

 

Adverts & All That!

BarbdwirequeenspartyhauntedpostaveburyrockswelbeingmikdedicoatScooterRallyposterNovonceupontimeartsfestdev

Reggae Inna Cellar, with Razah and Knati P

 

Can’t review your own gig, numb-nuts; see this as a reflection on our blinding reggae night down the Cellar Bar……….. 

 

Relying on public transport, our neighbouring Marlborough seems like a million miles away, a gamble you won’t be stuck in Avebury wandering the stones talking to some starry-eyed American beatnik about the wonders of crop circles.

But I thought it an idea to invite the very best Marlborough has to offer, in the genre I love the most, to our own cobble-stoned Cellar Bar last night. And boy, did it go off.

I arrived as early as my dinner would settle, to find a wall of speakers and a sound system in various stages of construction.

Ingrained, we are, of live music, one punter inquired when the band was going to play. This is sound system culture, a history richer than disco, a Jamaican ethos of music for the masses, stretching back seventy years beyond the ska sound of the sixties, to days of dub reggae, inspiring the bloc-parties of hip hop in the Bronx, and naturally, the free rave scene of the nineties.

The sound system pioneered not just techniques in amplification, but musical progression in ways the band or solo musician could never.

So, we are here, in 2019, if Devizes embraces tradition it sure took this surprise under its wing, as the Cellar Bar began to fill with our few reggae aficionados, hippies, old scooter boys, youthful passers-by and embraced a unity of all which only reggae can do.

You can sum this up with popular slogan and Marely anthem, One Love. Precisely what Razah, Knati P and crew blessed us with, giving up their time to play in aid of the homeless charity, Devizes Opendoors, under our banner of Devizine, and of which I’m forever in their debt for.

IMG_2742
Another bass-wobbly image by Devizine; except no substitute

A huge thanks goes out to the crew, painter and mentor, Knati P who brings the party with him, Nick, aka Razah, who technically made this work wonders, and gave me a few tips on playing on a big sound system, despite it looking like a confusing series of knobs, dials and lights to me!

I gave them a break and did a blast with my amateurish computer mix, as the crowds were yet to cotton on. Yep, should’ve publicised it better with posters, save relying on the followers of Devizine, yet Devizes should’ve heard of it by now, no excuses; help me to help you, sharing is caring, and word of mouth does wonders. Despite, as our first couple of gigs had no budget, and not wishing to dip into charity funds, was therefore experimental to see the power of the site and who pays attention to it; kind of worked, kind of didn’t. A few bods telling me they just passed by and heard the sweet music. Another notch in the idea of taking Devizine to the printers. Anyhoo, for future reference that.

With my mix from early ska to upbeat dub-ska over and done with, the professionals took control. In a blink the place was bustling. Beginning with popular reggae tunes and blending slowly towards a contemporary upbeat, jungle-like sound, only to finish where we started with Prince Buster’s One Step Beyond; that’s ska, people, please keep up!

IMG_2743
Christ on a bike; where are my photographers in my hour of need, huh?

No one shirked in the bottom seating area, even the dust on the old beams was jumping. Proof, I feel, reggae has a market here, fruitful and valid. Ergo, if you want to attract a crowd to your pub venue, with something differing from the norm, get in quick and book this Skanga sound system, the Knati P and friends reggae show, before someone else takes heed! My mission to force Devizes to be reggae-friendly has raised the bar, Knati, Nick and crew did an astounding job of convincing me.

A blinding, joyful atmosphere which needed no bouncer-presence; 99.9% here to party, as it should be. Mate, whoever you were to be so cheeky to ask bar-staff for a table knife, posing as a crew member with the task of taking the flags down, I’m not impressed with shadowing the good reputation growing in Devizes for our guests, who played for the love. You were only caught down the street anyway, with the spoils of a Bob Marley flag that you can buy online for £3.20; I’m not the local newspaper, and will refer to you publicly as a fucking knob-jockey.

Delighted to announce then, combined with last week we raised £225 for Devizes Opendoors, who work to provide homeless and people in sheltered accommodation comfort in a cooked breakie, takeaway lunch, wash and donated clothes, books, and importantly, a social environment with needed help and advice. The way things of going these days, this is the cold reality in our affluent town. Though minor compared with cities and larger towns, it’s real and it’s happening.

knati

Bugger me sideward with a barge-pole if I say I love reviewing my own gigs, I’m not here to boast, as it’s not about me. See this then as a diary-like blogpost, and tip for who I think needs greater attention on our scene. Thank you, for all the effort you’ve put in, to the attendees, Luke and staff at the Cellar Bar. Thanks to the previous Saturday’s acts; The Roughcut Rebels, The Hound on the Mountain, Gail Foster and those Truzzy Boys (hope you had a grand night at the Cons Club.) And a massive respect and one love to this week’s crew, particularly Sam, and to Razah and Knati P, who you can catch 8th June at a regular spot in the Wellington Arms, Marlborough, for the Queen’s Birthday Party. Whether the Queen will be there to skank the night away is yet unconfirmed but highly likely.

queensparty

We will prompt and notify you of future events from these guys, Devizine owes them big time. Meanwhile, I think there’s so much going on during the summer, time to concentrate on those. We are NOT an event organiser, we aim to promote those who do, but Devizine Presents does help me understand what organisers are up against. Not to say l won’t put something else on later in the year though, aiming to highlight our blossoming music scene and all that sail in her!

 

Adverts & All That General Malarkey!

owlfestBarbdwireonceupontimededicoatmikericernie0941596001555518913_all stars flyergruffalohauntedpost
skaingsheep

reggaealf
Make Devizes Reggae-Friendly with Devizine!

Cuban meets African, in Devizes: All About Grupo Lokito

You know, I have my ska-reggae show on Boot Boy radio, that’s while I’m so looking forward to Barb’dwire playing the Devizes Arts Festival in June, but feel I differ from its, generally, skinhead cohorts with instantaneous love for all Caribbean styles of music.

There’s something so colourful and lively in these many styles from the islands in the sun, but in my excitement for the ska night, I’ve overlooked the other intriguing main musical booking, London-based Afro-Cuban group Grupo Lokito, and wow, they sound tremendous!

Rhumba down to Corn Exchange on Saturday 15th June, where Grupo Lokito fuse contemporary Congolese and Cuban; I leave a few videos here, certain to wow you as they have me. In addition, we’re lucky enough to have Lokito’s manager and keyboardist, Sara McGuinness to enlighten.

grupo6

Keen to scoop some background, I asked Sara about managing a number of Cuban groups in London, Grupo Lokito being just one, and if they were Cuban by birth.

“I have played Cuban music and salsa for most of my life, as a piano player on the UK Latin scene,” Sara tells me. “In the mid-2000s I decided I wanted to investigate Congolese music, found a, at that time, vibrant underground Congolese music scene and started playing keyboards in a Congolese band. Congolese music is one of the few styles that is popular pan- Africa. The fact it has a modern but distinctly African sound is often cited as one of the reasons. It’s vibrant, fantastic music. What became clear to me the minute I started working with Congolese musicians within their community was that the music the African audience, the ‘home’ audience if you will, liked was quite distinct from the music favoured by the world music audience. The Congolese liked the old and the modern stuff, whereas the tastes of the world music audience stopped in the 60s. I loved the modern music that I was playing with the Congolese bands. Furthermore, I could see many similarities in performance practice and musical structure between that music and Cuban music. So, together with a Congolese singer, I wrote some tunes and we brought together musicians from the two traditions.”

“We were lucky as, working within both scenes, we had insider knowledge about who to work with. What was striking was that the two groups of musicians had never met each other or mixed at all before we brought them together in this band. Together in the band we worked hard to absorb each other’s musical styles. I was determined not to have a ‘fusion’ group which played a pastiche of the two styles. Grupo Lokito have a large original repertoire which combines different elements of Congolese and Cuban music. All of the band are dedicated to playing the music well and with an amazing groove.”

I asked Sara to breakdown the band’s origins.

“I’m the bandleader, born in the UK. The two lead singers, the lead guitarist and, on this occasion, the drummer are from the Democratic republic of Congo. The bass player and the percussionist are from Colombia and the trumpet player who is guesting with us on this occasion, is Cuban. What is more important than our origins are we are all Londoners, we have all chosen to make London our home and contribute to the rich cultural fabric of this great city.”

grupo1

This Cuban/Congolese fusion, I had to ask; are African fusions common in Cuba’s contemporary music scene, or something unique to Lokito?

“Absolutely not. My experience of Cuba is that most Cubans know very little about contemporary African music. Yes, there are many African derived musical traditions in Cuba but these hark back to an imagined Africa and African of 200 years ago. My experience is that initially the Congolese musicians I involved in the project had more idea about Cuban music, albeit a little old fashioned, than the Latinos did about Congolese music. The band is unique.”

The idea of an “imagined” Africa of yore is interesting, I think akin to all Caribbean music, particularly reggae. On Cuban styles though, I can’t believe it’s been over 20 years since the Buena Vista Social club album when, Ry Cooder popularised the genre. I wondered what Sara thought about this, does she think it’s been good for Cuban bands in the UK, as it’s probably the only album the masses would recognise from a bucket of “world music” albums.

grupo2

“The Buena Vista Social Club project certainly was part of the opening up of Cuba and popularity of Cuban music in the world,” she explains, “It is often said to be a Ry Cooper project, but was actually a consortium of Juan De Marcos Gonzales, Nick Gold (World Circuit) and Ry Cooder. They decided to bill it as Ry Cooder in order for the project to gain wider popularity and not just end up in the world music bin; it worked!”

“In terms of it being good for Cuban music in the UK there are positive and negative consequences. On the positive side; many people became interested in Cuban Son and there was more call for Cuban bands to play old style, Cuban Son. On a negative side, it did create a nostalgic, polarized image of what Cuban music is and created a standard repertoire that bands were required to play. In fact, the island of Cuba has a huge number of musical styles which have come out of the island, a product of the mix of cultures on the island: Mainly European and African but also Chinese, and other.”

My research suggested Cubano Son is the style associated with an African and Latin fusion in Cuba, which has been around since the 1920s. So, is Grupo Lokito similar? But does Sara think this wouldn’t be popular in Cuba today.

“I don’t agree Son is the style associate with African and Latin in Cuba,” Sara corrected me, I’m here to learn! “There are definite African and European roots to son,” Sara continues, “Son has been constantly developing since the 20s and, as you point out most people are not listening to son in the style of the 20s. Cuba has definitely opened up to the world and there is a lot of music coming out of Cuba now, from Jazz to Hip hop, timba, son.”

But Grupo Lokito brings together contemporary musicians from two musical traditions, okay, similar more so to Soukous, a popular dance music from the Congo Basin derived from Congolese rumba, or better still, stop pigeonholing Worrow! Grupo Lokito write their own original tunes: stories of life ranging from love tales, reflections on the trials facing musicians trying to make a home away from home, the wisdom of the elders, to the simple joy of dancing, and sounds awesome!

grupo3

To return this fascinating and enlightening chat to the beginning, what of reggae and ska, surely the most popular forms of Caribbean music in the UK, due to the Windrush generation. I asked Sara, what she thinks African, or Cuban styles would have to do to become as ingrained in our culture as them, is that even possible does she think, and is it something to aim for?

“I think it depends who ‘we’ are,” Sara replied. “There are many second, third and more generation British people of African descent and for them, the music of home is embedded in their culture. Latin-American music, in cities such as London, where there are large Latin American communities, particularly Colombian and again, second and third generations have Colombian musical styles ingrained in their culture. I definitely think that multi-cultural society is something we should be proud of. I do realise the London is a cultural bubble and the rest of the UK, particularly outside the large cities, is far less multi-cultural. If you look at some of the new music being created in the UK cities it will all be in there.”

Ah, but this be Devizes me lover! I’m extremely grateful for Sara’s time in chatting with us, must say, it’s a great example of the diversity on offer at this year’s Devizes Arts Festival, and something exotic and exciting for us bumpkins!

 

Tickets to Grupo Lokito are on sale now at £18.

 

Adverts & All That Malarkey!

artsbarndancereggaenightost18thowlfestBarbdwirehauntedpostericernieaveburyrocksdedicoatScooterRallyposterNovonceupontime0036273001555519004_outdoor training poster 20190941596001555518913_all stars flyer

 

De Novo; New Beginnings for Claire and Mark

 

What’s all this about then, another invitation to “like” a Facebook page? I was glad to catch up with Claire Gilchrist yesterday, as she announced a new venture with other former People Like Us originator, Mark Povey…….

The fresh electro-acoustic duo dubbed, De Novo, promises to “create something frickin’ stratospheric!”

Bassist Mark left People Like Us after a sell-out New Year’s Eve gig at the Three Crowns, Devizes back in 2017, while Claire left towards the end of last year. Let’s not dwell on details, I wanted to press Claire for what we can expect from this silver lining, for does she see it as thus? “Quite,” Claire agreed, and informed me, “De Novo is Latin for New Beginning.”

denovo2

But is De Novo something dreamed up on a whim, this Sunday afternoon in a beer garden? “No. Mark and I have been toying with the idea of a duo for a while now,” Claire explained, “but I was far from ready to sing again after last year.” The split from People Like Us left Claire disheartened, so we are pleased to hear she’s found her feet again, and that wonderfully punctual and expressive voice too, obviously.

But, what kind of music can we expect?

“We will be producing our own take on chart and album songs, old and new,” she explained.

How far do you plan to go back? I inquired, requesting them to give us some eighties!

“Foo’s,” Claire namedropped, “Beach Boys, Adele, Guns & Roses, The Police…” Then Erasure, The Human League, and Simple Minds were also cited.

A broad pop mix, “choosing your favourites?!” I asked.

“The One and Only!” came a knee-jerk reaction, I hope in jest! “Yes, but also songs that people won’t necessarily recognise.” The blurb on De Novo expresses: Anyone who knows either of us already will not be surprised to read that our duo will not be that of the ‘every day’ kind.

denovo4
Original People Like Us line-up, Andy, Nicky, Claire and Mark

Claire agreed with my belief, that it’s fascinating to cover songs, when putting your own stamp on them. But what about originals, has the duo their own compositions up their sleeves?

“Yes, Mark and I are songwriters.”

“Together?”

“Yes.” Claire was keen to open up to a little of her history, “I had a record deal with an independent label when I was in my early twenties. My song-writing partner and I had songs that were put forward to artists in Nashville, at the time.” Yet she sings and plays by ear, “I always need an ‘actual’ musician to realise stuff properly.”

denovo3

Mark and Claire are at “the very beginning of our musical journey together,” and we wish all the best for this promising duo, but are they ready?

“Not quite yet, we’re honing our act. We don’t want to go out and perform without being 100% happy and ready,” she explained, “but we’re hoping to pop up over the summer to give people a free taster and be gig-ready by September. Like flash-mob, out of the blue, street kinda stuff.”

“Buskers,” I jest, though Claire professed the importance of busking, informing me her idol KT Tunstall started as a busker. So, track their progress by giving the De Novo Facebook page your “like,” and we look forward to hearing from them soon.

 

Adverts & All That Malarkey!

artsbarndancereggaenightost18thopendoorquiztruzzyboysowlfestBarbdwireaveburyrocksdedicoatericernie0941596001555518913_all stars flyer0036273001555519004_outdoor training poster 2019onceupontimevinylrealm

Devizine Presents #1; Presented

All Photos used with the permission of Gail Foster, except the one of Gail herself!

 

Gimme a samba band, throw me an avant-garde minimalist techno breakbeat and then chastise me with a euro-pop grunge fusion played by an antelope on a washboard, I couldn’t give a donkey’s kidneys, all music is better than no music; shit, imagine a world without music.

1

Perhaps my taste too eclectic. I respect my supervisor’s dedication to one particular band, it’s borderline obsession; but me, see, I couldn’t reduce my tastes to a particular genre or era, let alone group. Bite the bullet, I can hold a conversation once tuned to wavelength, yet cause angered debate if I venture off your playlist. Bollocks, I say, any modern popular musical genre has been wired from the same machine, track the branch you sit on beyond the earth, and you’ll find the same roots.

2

For me, last night was a learning curve, as I staged our first “Devizine Presents” evening at the Cellar Bar. In communication with all these event organisers it helps me to comprehend the issues they face, and it’s not so simple as propping up the bar all smug, though I attempted to! All said, we had a great night I feel, but refrain from giving my own gig a review, treat this as a diary-fashioned blog post, but compulsory to give you the heads up on the guys who did all the real work.

4

Diverse the line-up may have been and contradictory to each other in style, I knew that, these acts slung together by an inexperienced promoter, me, under a banner of kindness to freely give their time and effort, for which I and Devizes Opendoors are both extremely grateful for. What the acts did bring was their own inimitable panache, and from Saturday Night at the Palladium to Britain’s Got Talent, variety is the spice.

3

Local, the Roughcut Rebels have been on the circuit a while, playing mod-rock and indie classics from sixties to today, however with major changes to the line-up, including Jamie, the new frontman it was a chance for them to showcase their modifications. Regrettably, I’ve never caught the original group, but confirm now the alteration is a transformation; they rocked with confidence, panache and flair through Animals, Small Faces and Kinks sixties blues-rock classics to benchmark eighties mod, resting particularly on The Jam, and progressing to Britpop anthems including a sublime take on Wonderwall.

IMG_2734

Ha, I ain’t making no money writing this crap, so just cos the gig has our tag doesn’t mean I’m here to flatter, you know I’ll tell it as it is. The Roughcut Rebels are highly bookable, would make a great band for a lively pub, scooter club, indie night or even are diverse enough to satisfy the multiplicity a wedding reception would crave.

With the moderate crowd building, (I need YOU at these nights, you know you bring the party, you little party-head, you!) and roused, having a poetry interlude could’ve been a mistake, as you could hear a penny drop; who was unaware that Gail Foster would charm and entertain with poignant verse and witty interims? Because I had no doubt, having do exactly this at our birthday bash back in November, and she did this time with equal appeal.

9

Now the cobblestone stage was set for the dreadlocked guy parading around attired bizarre, for Jordan Whatley is his own, is the wildcard and as noted in our interview (here) will bring something curious, peculiar to the show, but shine with original brilliance. Armed with just electric guitar, the ambience he set was spellbinding as he went through a set from his new works, previous tunes from his EP …… such as The Forest, to making Pink Floyd’s Another Brick his own.

7

The Hound is truly back on the Mountain, appearing alternative but positive, he’s the character you cannot deny his talent and showmanship, as his expressive spectacle sends him to the floor in an intense display of vivid gothic splendour.

10

Then it’s all change akin to the circle line at Edgware Road, as after a poignant Brexit verse from our Gail, The Truzzy Boys are raring to stamp their brand of acceptable pop covers on us. Speaking to Finley about his partner in crime under the Larkin banner, Sam Bishop, who unfortunately couldn’t make it, the DIY ethos of being unsigned means they’re not tied to their namesake. A contract would detail it’s Larkin or nothing, split or together, but Larkin continues albeit while Sam is away studying it’s on the backburner, they still hailed a welcomed night at the Southgate recently.

What Finely’s grouping with cousin Harvey Trusler brings to the show is contemporary pop-indie covers and floor-filling anthems with wide appeal, which did exactly that in the most practical means possible. Confident and harmonious they performed a set more than adequate for any age-ranging function, like a wedding. To boot, the musical family’s prodigy would also supply a disco set-up to complete any such function. This is industry, yes, but within the commercialism of it the boys maintain a positive love of performing, and this shines across the audience, sparking them with equally good vibes.

12

You can catch the Truzzy Boys this Saturday (18th May) at the Devizes Conservative Club, where for a mere three quid you’ll witness just what I mean; it’s catchy pop fun, with enjoyment throughout and the expertise not to meander into cliché pop mush.

Though I could tell you nothing else is going this coming Saturday, being we’re back at the Cellar Bar, Devizine exists to inform all of local events. It will not and does not favour any category or genre, will treat a church jumble sale and a four-day mud-fest gypsy rave with equal affection. Suitable then is my aforementioned eclectic tastes, or it would be bias, and that wouldn’t do. I aim to cast variety for these charity gigs, using the various venues at hand, if it’s to become a thing now.

15

Starting same time, same place this coming Saturday, is my “for instance;” Knati P, renowned on the international reggae scene with right-hand man, Razah I-Fi will be stacking up a sound system down that Cellar Bar, bringing us a dynamic dub party, something of a rarity here in the Vizes. They say, they might even let me operate the controls as a warm-up, where you can expect a set of original Jamaican ska, as my favoured palate, which will wind into lively ska inspired dub; that’s the plan at any rate. You will dance, you can be sure of that young fellow-me-jig.

reggaenightost18th

But again, I’m asking for donations, preferably a fiver, as I’m not out to hang myself on the music promoter vocation, not with the wonderful experienced ones we already have locally, from Mr Moore of Sheer, The Blues Club, Scooter Club, and Dean of Dead Kool now at the Cavy, to namedrop a few. I do however, ask for a contribution so we can hand it to our chosen charity, this time the homeless aids, Devizes Opendoors, who work towards making life that tad nicer for our rough sleepers and those in sheltered accommodation. I’m not here to get political on your ass, but with the way the country is going, this is more in need than ever.

6

So, delighted to say, Saturday night’s musical jaunt has raised £140 which will be banked along with takings to next weeks and handed to the charity. That in itself is a grand job, and I thank the Cellar Bar for having us, and to Harvey, Finely, Gail, Jordan, and The Roughcut Rebels; Doug, Jamie, Mark and John for giving a diverse and amazing night; cheers guys!

 

Adverts & All That!

dedicoatBarbdwireowlfest2badtownfestartsbarndance0941596001555518913_all stars flyer0036273001555519004_outdoor training poster 2019opendoorquizaveburyrocksericernieonceupontimehauntedpost

Up the Mountain to Chat with the Hound;

Jordan Whatley on his new EP, illness and influences.

 

If chat between songs on Tamsin Quin’s live CD commending the local music scene prompted me to an awakening, Saddleback’s Battle of the Bands in February last year opened my eyes and ears to exactly what she was extolling. A decade of parenting undermined my mindfulness of any such scene, yet I was to be inaugurated.

Bowled over by this acoustic assortment and now befriended Jamie, George, Mike, Sally and Jack, Jordan Whatley was one I never did get to greet. A distanced performer, masquerading under the pseudonom The Hound on the Mountain, he lay out on his knees before the panel of judges in a Hendrix screeching guitar moment. If there was an award for showmanship, he’d have owned it.

Keen to catch him again months later, in the group setting of The Compact Pussycat, I felt the shebang somewhat disjointed, the band proficient, Jordan spirited and acute too, but the combination fragmented. Later in the week Jordan and the Compact Pussycat went separate ways. This Melksham prodigy, feeling alienated, opened up about a mental illness to his Facebook followers, but returns to supplement his 2016 solo EP, Cernunnos with new material, and a live album from his recent gig at Bristol’s highly regarded Fleece.

jordan2

We hope to witness it when he arrives Saturday at the Cellar Bar for our charity-based Devizine Presents debut gig. Time to catch up with this hound methinks, for he is more hound than pussycat, and rap about this progression, dealing with his affliction, and investigate his influences.

Cernunnos is a roller-coaster of gothic ballads, fiery blues-rock psychedelia and indie-come-Britpop elevations. If the opening tune, The Forest astounds in goth traipse, building to an enraged frenzy, Ghosts of Your Past is the hauntingly psychedelic blues of Steppenwolf awash with Lewis Carroll references.

While Porcelain Trees perhaps the most emotionally drafted and executed, a gothic gradient of Bauhaus, Tin Can alleviates with a Britpop danceable anthemic riff. Yet the finale staunch punk into archetypical goth. Through diverse stimuli though it’s unified and uniquely Jordan. The passion to be himself and not deviate an attraction to his art, I was keen to engage him into what we should expect next. “So,” I asked, “you’ve a new EP coming, the years between occupied by working with the Compact Pussycat I take it?”

“Yeah sure thing, dude!” was the reply, “The EP was created in 2016 with Nine-Volt leap, put the project on hold due to the Compact Pussycat and getting back on it now. And yep, the live recording is finished, just editing it. Also, I’m starting new EP production next month.”

jordan3

But how does Jordan think it differs from Cernunnos?

“This next EP is gonna have a lot more creative process behind it,” he informed. “Beforehand, Cernunnos was made just after me leaving my acoustic scene behind, so was fairly vanilla, using basic structure and minimal instruments. This new album is gonna feature a lot of progressive structures, more electronics and I’m developing a story to run through it. I want this to be my saucer full of secrets; it’s gonna be complex and hopefully be something to show how much I’ve changed, musically and mentally, over the last few years.”

“A tune like Ghosts of your Past has complex narrative relating to Alice in Wonderland, it’d be good to hear a flowing theme right through the EP,” I observed. “Any similar cultural references, could I delve for a hint at a synopsis, or is it secret?!”

“I guess a lot of the psyche behind this is the concept of, almost, wicker man-esque cult themes; the kind of closed-end community’s dealing with their own myths and stuff. Alice in Wonderland will feature again, that’s more about the mental illness-based ideas of it, as someone who has dealt with mental illness it’s kind of weird, since describing it more as a being, prowling over you more than an invisible disease is something I’d like to put into words. To be honest, it’s gonna have a few themes that I’m hoping I can finetune together. Gonna have some other musicians working with me on it too.”

“Yes,” absorbed with his openness about psychological impetuses clearly portrayed in his writings, “you publicly spoke about depression/mental illness on Facebook a few months ago. Do you think it can be part-and-parcel with the creative mind; the bleeding hearts of artists and all that?”

“I wouldn’t say it’s the whole damaged soul thing,” Jordan replied, “I feel it’s more that it just makes you a bit more open to ideas, and sort of a little more comfortable with expressing certain topics.”

I pressed on this, “I often think it’s what separates the true artist from the media whore, just in it for the money. Not mental illness necessarily, but a wilder, crazy side is no bad thing provided it’s channelled into art.”

I thanked Jordan for his time, touching on the, perhaps, incoherent ambience surrounding the final Pussycat gig, despite all being accomplished and talented musicians. “Yeah,” he explained, “I enjoy working on music that I would like to watch live more than something I think will be popular; I’m doing it for me after all!”

jordan4.jpg

In a nutshell that’s what I like about Jordan, I was a window-shopper of goth, something I never popped into purchase, but winked at the cute and curiosity shop-worker garbed in black gown and eyeliner; knowing Robert Smith’s lyrics in school was the difference from getting a snog, or not. Yet, The Hound on the Mountain turns my eclectic taste simply because he is who he is; “never try to be anything other,” I offered.

Previously I’ve mentioned the Doors comparison, as Morrison could hold that audience spellbound; probably easier for him as his audience were all tripping, but still, Jordan has a similar presence. So, who does he cite as influences? Does he describe his music with the “goth” label?

“Yeah,” he tended to agree, “this is showing off more influences, from the kind of Joy Division, Nick Cave, Bauhaus and Portishead side! The kind of Jim Morrison frontman still comes out, but you know I can’t be too ordinary, ha-ha; and yeah kinda, alt-gothic shoe gaze rock!”

Devizine welcomes this Madhatter Hound on the Mountain on Saturday 11th May, at the Cellar Bar Saturday 11th May, at the Cellar Bar with the Roughcut Rebels and Truzzy Boys also gratefully agreeing to contribute their time to raise some pocket money for worthy homeless charity, Devizes Opendoors; please do come along!

 

Adverts & All That Malarkey!

presents1a4poster[3646]trintymayfairtownbandartsbarndanceopendoorquizreggaenightost18thBarbdwirededicoat2badowlfest0941596001555518913_all stars flyer0036273001555519004_outdoor training poster 2019curveballsaveburyrocksericernieonceupontimehauntedpostvinylrealm

Daydream Runaways Light a Spark

“Somethings end just for others to start. Some begin are just the lighting of a spark.” Recurring loops of life the theme of Daydream Runaway’s debut single, “Light the Spark.” Self-reflecting, perhaps, as this emotive, Killers-styled, smooth danceable indie harmony rings with poignant guitar breaks akin to Simple Minds, and the expressive vocals of U2.

 
There’s optimistic Talking Heads echo in the song too; declares newly-formed Daydream Runaways will indeed light a spark on our local music scene. Devizes based vocalist, Ben Heathcote has that definitive holler of sentiment and passion, complimented with an imperturbable accompaniment of Cam Bianchi on Guitar, Nath Heathcote on Bass and drummer, Brad Kinsey.

This is a breezy and confident introduction to a band only formed in January, and if its an overview, Daydream Runaways is definitely one to watch. The song is released on Wednesday, the 8th May, so spare a “like” on their Facebook page, as this is a very likeable and promising start. Nice one guys!

 

Adverts & That!

a4poster[3646]presents1reggaenightost18thopendoorquizowlfestBarbdwireartsbarndanceaveburyrocksericernieonceupontime

Twit Twoo: Owl Fest Announce Line Up

Breaking and brilliant news as Adam Dempsey pings over the line up for this year’s Owl Fest on Saturday May 25th in Bromham’s social club, The Owl. Chained to that kitchen sink again, I dried my hands on a tea towel quick as I could to reply what a fantastic line up, I reckon it is. He thinks it’s their best yet.

 
So, no more suspense, and in no particular order, it’s that five-piece classic rock covers band, Homer. Citing influences as wide as The Undertones and Buzzcocks to Thin Lizzy, Steppenwolf and Red-Hot Chili Peppers to AC/DC, Homer’s been on the local scene since 2012. Frontman Pete Pig, Danny Silvers on drums and backing vocals, guitarists Paul “Winger” Weinling and Les Vegas, with Graham the crazy bassist, are sure to rock Bromham.

homer

Devizine favourite Jamie R Hawkins will be there, with acute and sentimental storytelling brilliance, Jamie never fails to impress.

m17

Everyone’s favourite, Mr George Wilding will also do his stuff. With natural ability and ease, astounding originals solo and with Wilding, George is surely Wiltshire’s imminent legend.

n8

And you must love tiny country-pop princess, Kirsty Clinch with her bountiful talent and energy.

54800212_1393620857446899_4156153725360013312_n

Malmesbury’s Corky also returns with his hilariously original brand of acoustic “scrumpy and western” agricultural hip hop, had me in fits of laughter before the cider even took its natural course at last year’s.

20180526_185458_resized

My wild card, The Gentle Crows appear; not heard of these guys, I confess, but acclaimed rock covers they promise with great reviews online to date.

 
Topped off with Trusler senior’s Funked Up duo with Mark Colin Jones, with their brand of eighties funky-pop-rock, not forgetting the great selection of ciders on offer, food, I’m sure you’ll agree, The Owl is worthwhile heading towards on May 25th. See our review of last year’s here, and see you there, I hope!

 
The day is FREE, but if you want to use the Cider bar, you’ll need a wristband and plastic glass which sets you back a whole £8, and includes two tokens; why wouldn’t you?!

 

Adverts & All That!

borntorumpresents1reggaenightost18thBarbdwiregrandesophiawoodland2badartsbarndancea4poster[3646]hauntedpost0941596001555518913_all stars flyer0036273001555519004_outdoor training poster 2019ericernieopendoorquizcurveballsaveburyrocksonceupontimeScooterRallyposterNovvinylrealm

Barb’d Wire and Corn Exchanging; Reggae Finds a Home at Devizes Arts Festival

Never content with what contemporary music thrust down our throats, even as a youngster, the easiest and sneakiest place to hunt for origins was Dad’s record collection. It would be years before he discovered the shortfall of vinyl and confronted me. Sixties Merseybeat and blues-pop standard, I recall the intriguing moment I unearthed a shabby cover of a girl’s naked torso, “Tighten Up Vol 2” was inscribed on her abdomen in lipstick. So, when he did, I inquired why he bought this, Trojan Record. More concerned where his Pink Floyd gatefold had vanished to, he half-heartedly explained, “it was something different,” as if he didn’t wish to divulge too much, “and cheap.”

bradtu

The estate of Bob Marley is still argued over, he never understood how to handle the royalties of rock star. Other than a BMW he had no extravagance, the house on Hope Road a gift from Blackwell, in which he lobbed a single mattress in the corner of a bedroom. What you see of the Jamaican music industry in the movie, “The Harder they Come,” is staunchly realistic; peanuts a too expensive commodity to compare to payments made to singers and musicians.

Poor wages triggered a prolific industry, hundreds of hopefuls jammed Orange Street awaiting to be ripped off. Trojan Records was founded the year after Bluebeat dissolved, 1968. The reasoning both English labels sourced Jamaican music was originally to supply the Windrush generation with the sounds of home, it is doubtful either realised the legacy they would leave. The underpaid nobodies singing on these records meant Bluebeat and Trojan could lower the price tag when compared to what upstarts like Bowie or Clapton would require, and price was everything for white British kids attempting to amass vinyl for house parties; as my father summed up.

bard5twotone logo

Though the attraction may’ve been the price, the enticement of these records came when the needle hit the groove; these rhythms were insatiably beguiling and exotic. I felt that ambiance too, and fell head over heels. But my palette had been preconditioned without comprehending it. Slightly too young to have immersed in the youth cultures of the late seventies, the sound bequest our pop charts.

Whether it was Blondie or the Police, or Madness, The Beat, or Piranhas, the charts of pre electronica eighties was inspired by the two youth cultures of punk and skinhead, and until the day I discovered a Bluebeat 7” of Prince Buster’s Madness, exposing Suggs and his Nutty Boy’s embodiment, I had no idea. Jerry Dammers’ Two Tone Records only had six years, an insecure contract with a get-out clause after one single, saw the acts achieve acclaim and jump ship.

Barbdwire

bard3

But if we celebrated Trojan’s fiftieth last year, we must do the same for Two-Tone’s fortieth, as it engraved its hometown, Coventry, as firmly on the ska map as Kingston. Within its short run Two Tone defined an era and reintroduced the roots of the dub reggae scene that punk spurred to white British youth; ska. The nonchalant rudimentary street-styled design of Two-Tone’s corporate identity is today considered standard ska practise; Dave Storey’s chequered monochrome background with Walt Jabsco, a character based upon a Peter Tosh image.

bard4tosh

It may have challenged punk with chicness akin to mod, but today, these subcultures are inconsequential, we can bundle it all into one retrospective burlesque, select whatever element of any of them and fuse them without pretence or offense; one reason why a group like Barb’d Wire is fresh and electrifying.

Though hailing from Two Tone’s home, Coventry, drummer and vocalist, Trevor Evans, a.k.a. ET Rockers, having begun his sparkling career as roadie turned DJ for The Specials, and with a brass section arrangement by Jon Pudge, ska is only an element of Barb’d Wire’s sound. Guitarist Ryan Every, Fingers Aitken on bass, and Mark Bigz Smith commanding the keys, blend influences as far and wide as punk to orchestral and blues into a melting pot of reggae. Fronted by the spiralling, gospel-inspired vocals of Cherelle Harding, their unique sound drives a heavy dub bassline, while not divulging on its preconditioned instrumental ethos. What we’re left with is a genuinely contemporary reggae lattice landing the group as firm favourites on the dynamic Coventry scene and festival circuit such as Skamouth.

 

While tracks like Duppy Town and Et Rockers Up Town, on their 2017 debut album, Time Has Come, rely on dub, a stepper’s riddim thrives throughout, but incorporates aforementioned influences. The only recognisable cover, for example, is the classic Latino-inspired Rockfort Rock of which the Skatalites perfected a ska-rhumba amalgamation. Produced by Roger Lomas, who also handles Bad Manners and The Selecter, again, Barb’d Wire pride themselves with Two-Tone influences, yet unlike the standard ska cover band you’re likely to get on our local scene, who all have their place in maintaining a clandestine but welcomed scene here, Barb’d Wire will be a fresh and welcomed gig, when they arrive at Devizes Corn Exchange on Saturday 1st June as a feature of Devizes Arts Festival.

bard2

For me, and any reggae/ska/soul aficionado, this is simply unmissable, but for the Arts Festival it may be a risky move, breaking their typical booking in search for newer audiences. While organ recitals, poetry slams and theatre noir have their place, we owe it to ourselves to support this event in hope it will spur future events at the festival of an alternative and contemporary genre. That is why you’ll see our Devizine logo proudly on the posters for this particular appearance, as though we plan to bring you more in-depth previews and reviews of this year’s stunning line-up, I’m most excited about this one!

 

Saturday 1st June: Tickets available now, £18

 

Adverts & All That!

borntorumgrandepresents1reggaenightost18th0036273001555519004_outdoor training poster 20190941596001555518913_all stars flyerericernieartsbarndancevinylrealmopendoorquiza4poster[3646]aveburyrocksskaingsheeponceupontimehauntedpost

What a May Day! Things to do This Month; Part 2

Hark, the darling buds of May. Already looking quite blossomy isn’t it? Well, blossoming too is stuff to do in and around our local neighbourhood, and a few weeks ago I presented you with a lengthy look at what’s on during the first fortnight; see here.

Now though, sit down and brace yourself for some shocking news. I have, actually produced the second part of the monthly preview, and here it is! Though promised with previous months, I tend to side-track, or just plain scatter-brain and not carried it through. Not so this time, you don’t have to thank me, unless you have a choc n nut Cornetto.

Week 3: Mon 13th – Sunday 19th May

Regular sing-a-long at Devizes Folk Club in the Lamb, Devizes on Monday, similar on Tuesday if your go to the Bradford Folk Club, 8pm in the Cellar Bar of the Swan Hotel. Meanwhile, St James Wine Vaults in Bath where Radical Westie Productions presents Daisy, Television Villain, Ravetank and Devizine favourites Nerve Endings; £3 door tax.

Wednesday 15th, and Peter Vaughan does pasta at Vaughan’s Kitchen Cookery School, later don’t forget the acoustic jam at The Southgate, Devizes.

There’s Bach Suites by Orchestra of the Age of Enlightenment: Young Artists Anima Fidis Quartet at the Wiltshire Music Centre Bradford on Avon.

Thursday’s is acoustic night at The Royal Oak, Corsham. Hannah Rose Platt and Black Sheep Apprentice at The Tuppenny, Swindon or tribute night with The Quo Experience at The Cheese & Grain, Frome.

artsbarndance

There’s a barn dance on Friday 17th at the West Lavington Hall. Usually wouldn’t make a song and dance out of such, but all proceeds go to the wonderful charity Arts Together; read about my visit, and the great work they do, here. Please support Arts Together, they’ve music, buffet, bar and raffle, see the poster for details. Future Devizine Presents nights will also like to donate to Arts Together.

smokedonuts.jpg

Sheer Music is back in Devizes, the Cellar Bar has Smokin’ Donuts; one-part Carter USM and t’other festival cult hero, Doozer McDooze. Brilliant indie-pop Talk In Code and the talented Jezilyn Martyn support. £7 advance from Sheer Music, a tenner on the door.

But if you thought Devizes was a one-gig Friday town, you’d be very much mistaken. There’s Johnny 2 Bad, an eight-piece boasting to be the UK’s number one UB40 tribute at The Cavalier Community Hall. Except the reggae train-spotter in me upheaves that Johnny Too Bad is actually by The Slickers and only covered by UB40, eh? Bit of reggae in the Vizes, though; never going to knock it. £10 in advance and should be great night.

2bad

It’s rather retrospective in the Southgate too, with sixties garage and Mod band, Absolute Beginners at The Southgate playing a debut in the town. Three-piece playing covers of songs by The Who, The Small Faces, The Kinks, The Eyes, The Creation, The Jam, Secret Affair, Squire, and The Purple Hearts.

Without a cinema, the Assembly Hall in Melksham shows movies, The Favourite is on Friday. Break Cover are at The Talbot, Calne. An Open Mic at The Pump, Trowbridge. Comedy Night at the Boat House, Bradford on Avon. Tensheds live at the Rolly in Swindon and amusingly named Antarctic Monkeys at the Cheese & Grain, Frome.

reggaenightost18th

opendoorquiz

Back on reggae for Saturday, although other events are available, it’s Devzine’s second gig of the month, a reggae and ska night at the Cellar Bar with Knati P and Razah and I’ll be warming up for them with a ska show live. Look, again I’m asking you to come along, listing door damage as a fiver but as long as you give us what you can, that’s good enough. For all the proceeds go to homeless charity, Devizes Opendoors. For want of a quieter evening Opendoors also have a Quiz Night from 7pm at Nursteed Community Centre.

Those Truzzy Boys play the Conservative Club in Devizes, £3 on the door, Drew Bryant at The Southgate, and Sound Affects support the Dusk Brothers at the Cavalier’s Ameripolitan Music Club. Meanwhile, The Wharf Theatre welcome back Hancock clone, James Hurn, with new scripts.

truzzy

Brother from Another at the Woodbridge Inn, Pewsey, and Woodborough Social Club has Humdinger. Blues Bros & The Commitments at Melksham Assembly Hall. Còig at the Wiltshire Music Centre, Bradford on Avon while the Neeld Chippenham has medium Derek Acorah.

Fresh from Montreal LG Breton and drummer Marco Dionne joins Phil Cooper for his Vise-Versa tour, closet to us is Saturday at the Village Pump, Trowbridge, other dates here: http://phil-cooper.co.uk/tour-dates

Sunday 19th sees the Chippenham Soap Box Derby and John Etheridge’s Sweet Chorus is at the Wiltshire Music Centre, Bradford on Avon.

Week 4: 20th -26th May

 

Devizes Folk Club down The Lamb on Monday, An Evening with Graham Gooch at the Neeld, Chippenham on Tuesday. Acoustic Jam at The Southgate, The Royal Ballet’s Mixed Triple Bill at Wiltshire Music Centre, and The Waterboys @ Bath Forum on Wednesday.

Thursday is Acoustic Oak night at The Royal Oak, Corsham. Boxing Day and All Better play Level III in Swindon, and Carus Thompson is at The Beehive. But if you ever doubted summer is on its way, the bank holiday truly kicks off festival season, with Bearded Theory’s Spring Gathering in W. Midlands, or most fruitfully funky and stunningly popular dance fest, Shindig starts in Bruton. Shindig Festival is a glorious mash up of a gig, a house party, circus show, comedy night, a wellbeing retreat and kid’s party. No main stages, just an arrangement of stretch marquees, so you can be in amongst it, or chill on the grass. Kids can learn to DJ, breakdance and urban art.

This crazy weekend sees Chippenham Folk Festival starting Friday, as does Lechlade Festival. With Salisbury Live beginning, and Frome’s R&B festival with Frankie Miller’s Full House at the Cheese & Grain, you’re spoiled for choice.

Back in Devizes, Friday 24th, Bob Drury pays tribute to Neil Diamond at The Wharf Theatre. Adriano Adewele, Gwilym Simcock and Jason Rebello are at the Wiltshire Music Centre, Bradford on Avon. While in Swindon, the Wyvern Theatre presents The Rolling Stones Story, Sheer Music has Press To Meco at Level III and there’s a Ska’mageddon at the Vic with SN Dubstation and King’s Alias @ The Vic, but for real roots adventurers, try RDK Hi-Fi meets Roots Inspiration @ Black Swan, Bristol. I’m steering clear of Bristol as there’s too much to list, but that one will go off.

Saturday then, the 25th. Long Street Blues Club celebrate the music of one of rock’s best-loved icons Paul Kossoff, with May Kossoff the band. A chilled but robust night is promised at the Southgate, with Nick Tann’s British folk take on Americana heartland traditions.

owlfest19
It’s also time for Bromham to host the second combined cider and music extravaganza, OwlFest at the Owl, obviously. Did this last year, loved this last year, although I’ve no line-up info for you, you can bet your Bromham dollar this’ll be great. Another to watch is Marland’s showpiece, Gladstonebury at the Gladstone Arms, Chippenham, expect Steve Morano, the Sweet Swing Trio, The Chicken Teddys and Burbank.
Loud soulful, happy vibes will come from The Pilot, Melksham where Big Mama’s Banned play. The Gimme Gimme Gimmes and Devizine favs, The One Chord Wonders are at St James Wine Vaults, Bath, Frome’s R&B Festival continues at the Cheese & Grain with Geno Washington & The Ram Jam Band.

The old English spelling of Savernake Forest, Safernoc inspires an intriguing event in Marlborough on Saturday too; “violin, voice and banjo music from the 16th century to the present day, world premiere of Paul Elwood’s Safernoc; a series of compositions for mezzo soprano Alice Simmons and violinist Tam Coates by composer Paul Elwood. Both Simmons and Coates live near the forest and both have found inspiration in the shadows of that ecosystem. The text by the composer is a play on trees and an imagined impression of Savernake taken from Dante, Bernini’s sculpture of Daphne transforming into a tree, and Mexican painter (Sister) Juana Beatriz de la Fuente’s, “The Tree of Life.” Admission £10, email contactamitytrio@gmail.com for tickets.

savernake

Alex Roberts Live at The Southgate on Sunday 26th, the wonderful Sugar Motown returns to the Three Crowns. While Dr Feelgood plays the Frome R&B Festival at the Cheese & Grain.

End of May, Mon 27th – Friday 31st

Proper West Country, it’s the Coopers Hill Cheese Roll at Brockworth on Monday, Frome’s R&B Festival has Nick Lowe & Los Straightjackets.

With Bandeoke at Chippenham’s Neeld and Jackie & Felix Byrne at the Bradford Folk Club, that makes up Tuesday, while Wednesday it’s the World Music Club at The Beehive in Swindon, and of course, an acoustic jam at The Southgate, Devizes.

You can Meet the Gruffalo at Hillworth Park in Devizes on Thursday 30th, for his 20th birthday, Devizes Books bring the books, with a trail around the park, a prize draw and guest appearances, should be fun for kids of all ages.

gruffalo

Acoustic Oak at The Royal Oak, Corsham and Jonathan James is Discovering Music at the Wiltshire Music Centre, Bradford on Avon, while tribute The Commitments Experience are at the Neeld, Chippenham and Gaz Coombes is at the Cheese @ Grain.

That’s the month of May done, Friday 31st the Brodsky Quartet are at the Wiltshire Music Centre, Bradford on Avon and Salisbury Live continues. Other than this, seems like a quiet Friday, save for the fact it’s time for the opening of the Devizes Arts Festival, I think it’s the best line-up yet, starting with An Audience with John Simpson at Corn Exchange. Check our preview of the festival here, and I will be highlighting some of the separate events as the month goes on.

More details of all events here are on our event calendar which makes up Devizine’s busy home page, but bear in mind this is not a exhaustive list, the calendar is updated (nearly) every day, so keep checking for updates; too much of it to continuously post to Facebook, you need to check in every now and then, or you might miss something you need tickets for.

Have a grand and blossoming May, it’s building up to a great summer ahead!

 

Adverts & All That Malarkey!

seendbbberborntorumgrandehopdogartsbarndancepresents1townband0941596001555518913_all stars flyer0036273001555519004_outdoor training poster 2019townfestaveburyrockssophiawoodlanda4poster[3646]opendoorquizericernieartsfestdevhauntedpostonceupontimevinylrealm

Half a Review from The Southgate: Soapbox and Patrick Goodenough

Yeah, I know…..

yeahiknow

What’s Devizine coming to when I back out of a full night of live music? But with jam-packed weekends ahead, general fatigue and, like Suggs, sometimes I like to stay in and watch TV now and then, please allow my lethargy some slack, people. Britain’s Got Talent’s non-offensive new look of letting every idiot through was wearing thin by the second act, and I ventured off for a pint. Wasn’t a great deal to wet this lightweight’s appetite anyways, save George Wilding down the Owl, and of course, if you’re ever stuck for a weekend evening’s entertainment, the Southgate is the guaranteed safe bet in the Vizes.

Yet it’s walking up that Dunkirk Hill which drains enthusiasm, so steep Churchill pulled the troops out. Fine, it is, to roll back down at the end with a bellyful of cider navigating me off-route down Browfort, as it did last weekend, and perhaps it was this occurrence which avowed the need to drive.

I knew Nerve Endings were booked; knew they had a support, and still I epically failed, but was impressed with what I did perchance to witness, and thus prepared to draft a little something about that. Yep, the Southgate rocked again, and I know, you know, Mike, Luke and Rob will make a grand, and loud job of it. On bass and vocals, Rob McKelvey and brilliant drummer from the valley, Luke Bartels really add the extra dimension to Mike Barham, if he ever needed one; shame I shirked it.

soap2

But Patrick Goodenough, who kicked off the proceedings with a solo debut of stripped back songs from his band, The Compact Pussycat, was indeed more than good enough, as his name suggests. There was emotion and sentiment in his performance, and popping his solo act virginity, with added banter of band-member Jack Moore floating around, he should be highly commended.

Following this, Salisbury three-piece, Soapbox came to kick-ass. Proclaiming it was their heaviest song to date, they blasted out an introduction called “Problems,” and thus was the general theme of these lively and edgy, punk-inspired, rock n roll originals.

Acutely written shards of anarchy and virtue, they packed attitude and were delivered ferociously yet responsively, a tune called Rollercoaster, for example, cliché life metaphor perhaps, but delivered with passion and enthusiasm. There was an acceptable Iggy Pop in them, The Rabbit Ear perhaps the most poignant, and the final lambast, Shut the Fuck Up, the most direct.

soap3

I nodded approval as the bass player packed away, telling me though they’d sporadically been together as a band in the past, this incarnation has only been on the circuit a year. With this in mind, excusing myself doing the need-a-wee dance, Soapbox is defo one to watch out for. Good choice Mr B, apologies for my slackness!

 

Adverts & All That!

borntoruma4poster[3646]presents1artsbarndancereggaenightost18thopendoorquiz0941596001555518913_all stars flyer0036273001555519004_outdoor training poster 2019ericernieaveburyrockshauntedpostonceupontimevinylrealm

 

Jemma’s Thoughts (well, some of them) on Things I Know to be True @ The Wharf Theatre

As big chief of the Invitation Theatre Company and partner of Anthony, conductor of The Full Tone Orchestra, you cannot deny, Jemma Brown knows a thing or two about performing arts, so I’ve pinched her words of praise after watching Things I Know to be True at the Wharf Theatre…….

Jemma Brown – 26.4.19

I don’t think I have ever heard so many people, prior to me going to see something, telling me how incredible it is. So, it was with a gently raised eyebrow, that I went to see Andrew Bovell’s Things I Know to be True – directed by a friend, with good friends in it, on a stage that has an awful lot of personal connection, I girded my loins. Now before I launch into what I thought of it all, one must know that I am horribly critical, an awful theatre goer, and the fact that I know the performers and director, my thoughts must not be deemed as bias. Because I would tell you how it is.

It was totally and utterly beautiful. Beautiful.

It made me think about every single possible aspect of life. The love, the pain, the happiness, the sadness, the euphoria, the devastation. And, what’s important.

The set – simple, sensual, unfussy – was the perfect setting for what lay ahead. Six breathtakingly superb performers, performing a piece that is so brilliantly written meant I was hooked from the second it started. The lighting, and the setting was sublime. I loved the fact simple accents were used, because it meant each cast member could grasp the text and tell the story and it made them all the more relatable.

ThingsIKnowToBeTrue

The use of film, laying out a relationship of a family, was an inspired and delicate way to set everything out. We knew from it, that we were going to be meeting a family who loved each other. It drew me in, and it made me gently weep. And how it made me feel at the end…. not everything you see is how it is. The things you know, they change, and they grow.

Interspersed throughout was the most wonderful physical theatre, to the most brilliantly chosen music that enveloped you. The dance elements fell into place like a comfortable shoe, as though it was the most natural thing in the world. And they made me brim with tears. The interconnections between the family was brought to life by this touch and made all the more powerful by the tenderness as it was steered by the cast. A glass of wine that passed from one to another at one point, like it floated. The brother and sister connection that playfully danced.

The coming together of all of them to support and move and just be there, in gentle, significant movements was just stunning. The scene at the end was quite simply one of the most powerful and beautifully executed pieces of theatre I have ever seen. I couldn’t get out of the theatre quick enough at the end so I could get to my car and howl. And I sobbed. I sobbed because of the story, but I sobbed because those six people, the director and the technical team had created something so beautiful, it was all I could do. When I got home, I couldn’t explain what I had just seen, I sobbed and I jumbled a sobbing garble to my husband about what I had just seen. I held my daughter so tight and just could not tell her deeply enough how much I loved her. The effect the whole production had on me was profound. And I really am not the only one. This play has deeply touched everyone who has seen it.

The four children were played by four exceptional actors, each of whom played their roles with such excellence, I found myself wondering why they aren’t all on the professional stage. I forgot I was at The Wharf and that they all have normal lives. They handled their characters with such care and maturity – real kudos to Freddie Underwood and her exemplary direction. I just knew that rehearsal process had been special, that what they had undertaken was a passion for the text and for their director. Because it showed.

Jessica Whiley as Rosie was enchanting. Her storytelling and perfect diction had me feeling and believing and imagining every single thing she was telling us. I felt the love she felt, I felt the passion she had had and I wanted to go home and share a bowl of cereal with the love of MY life. She captured the sense of travelling but wanting to be at home just perfectly. Her performance throughout was captivating. She broke my heart at the end of the play, her gentle voice and the beautiful but devastating words that came tumbling out of her mouth made me want to bawl. Her performance was outstanding.

Lou Cox, a stalwart of theatre, surpassed my expectations as Pip. Her characterisation of the role drew you in and you felt every feeling that she had. Her brilliant usage of inflections and the light and shade of her expertly executed use of the stage and the script meant that you knew who she was, her relationship with her mother and her siblings. Her relationship with every other character on stage was real and unmistakable. Lou’s handling of the character meant you knew exactly who Pip was, it was a striking and beautiful performance. I felt the pull she felt and that earth-shattering realisation that you need to follow your heart.

Fraser Normington as Ben – I loved him. His flexibility within the character was excellent. He caught the busyness of his life perfectly. He looked good, he sounded good and when he royally messed up, his manic panic was caught so brilliantly, I thought I was going to have a panic attack.

Karl Montgomery-Williams played the role of Mark magnificently. We knew something was wrong, he brought something to the stage when we first met him that we could just feel there wasn’t something right. As it unfolded, his storytelling was exquisite. His sensitivity to the subject, his relationship with Rosie and the response to his parents, was heartbreakingly brilliant. Again, you just felt every emotion, every word. His performance was remarkable.

Debby Wilkinson and Paul Butler as Fran and Bob. Well what can I say. I have seen these two perform and have been lucky enough to be on stage with both of them. They blew me away. Paul was bimbling and kind, and his parenting was just what every child needs; calm, gentle, principled. You yet again, felt who he was and felt every inch of his loyalty to his wife and the life they had made together and that he had always done what he thought was right. His aversion to swearing and how he reacted to it made you never want to swear again – yet his ‘F*CK YOU’ was one of the highlights for me. Because it came from Paul as Bob in such a way at the direction towards his son, the disappointment and pure and innate despair, was palpable. It hung in the air, it bounced around the theatre, we felt it. But his relationship with his wife was beautiful was what I loved the most – he broke my heart, his performance when he broke was simply heartbreakingly beautiful – his collapsing on his beloved roses made me want to howl, holding that in was near on impossible, but he captured absolute, all-encompassing pain, gut wrenchingly perfectly.

In response to his portrayal of Bob, Debby played the part of Fran with extraordinary professionalism and realism. She was quite truly excellent. Her connections with the words, the emotion, her relationship with each of her children was breathtakingly intense. She made me feel like I didn’t know who she was – I thought I had her, then she changed. A friend of mine hated her character, describing her as a bitch – I didn’t see her as a bitch, I just saw her and felt her as someone who just didn’t quite know how to ‘be’, her children were all different and the one who was the most like her was the one who she loathed.

So, was she self-loathing? Was that what the problem was? I just did not know, and that was down to how to she was directed, but also how she interpreted such a great and complex piece of writing that captured so many issues and feeling and life experiences. Her handling of the character, the script, the stunning, stunning movement that was incorporated and then her explosion at one of her sons that simply took my breath away, made me weep – her brilliance made me weep.

The production was better than clever. There is just so much in it to talk about. The characterisations of each character left me totally unable to explain what I had just seen. The lighting and music made me want to tap on the lighting box door and tell them how excellently they had handled it all (a real rarity), but the whole vision from the director that had spilled out onto the stage and in her performers, was exemplary. The pure emotion that had been poured into every single aspect was truly on a professional level. It did, quite frankly, blow me away. Even when I sensed there might have been a few line struggles, it just didn’t matter. It was slick, it was calm, and you felt them all working together to make the whole thing ‘happen’.

One thing I know to be true, was that it was, quite frankly, one of the best pieces of live theatre I have ever seen.
And not just because it is an incredible script, but because of who directed it, her tech team and who she had cast to be in it.

 

Advertisements

a4poster[3646]presents1borntorumopendoorquiz0036273001555519004_outdoor training poster 20190941596001555518913_all stars flyerreggaenightost18thartsbarndancegruffalogeorgewildingowlaveburyrocksericernieonceupontimehauntedpost

Two Stories of Vinyl, Realm

Last week when I spoke to Pete Bennett, he had his sleeves rolled up and was preparing to finish painting the basement of Devizes’ only record shop, Vinyl Realm, and it looks like the work is complete.

Pete says he’s “proud to announce the second floor at Vinyl Realm is now open to the public, tomorrow, 27th April. We’ve so much more, good, clean second-hand vinyl, LP’s, EP’s & 7″ singles on offer. Albums and singles start at £1. We have increased our offering of titles on new 180g vinyl to 70+, prices start at £14.95, albums including Rock, Alternative, Reggae and Blues. Also coming is more home audio HiFi, Specialist Cables, PA and more bits & bobs.”

It was never going to be an easy task maintaining a traditional record shop in a town like Devizes, some even put a date on Vinyl Realm, but since I parked my milk float in the snow the day before its opening to take a peek at their progress, I’ve been continuous impressed by the store, the staff and of course, its contents.

pete2.jpg

It has provided an intimate setting for local bands and singers to perform to passing public in the day, staged several gigs in the Lamb’s Fold, and now strives to provide a younger generation a place to gather with dance music nights at the Fold.

Pete continued by thanking his staff, helpers and the builder for making this happen. Long live Vinyl Realm!

 

Adverts & All That!


vinylrealmpresents1reggaenightost18thborntorumgeorgewildingowl0941596001555518913_all stars flyer0036273001555519004_outdoor training poster 2019curveballsericernieaveburyrocksonceupontimehauntedpost

What a May Day! Things to do Next Month; Part 1

Now your Easter eggs are nothing but screwed up tin foil it’s time to look towards May, and what’s in store for us during this early summer month. Part one, let’s get the first fortnight over and done with.

 

Week 1: Wednesday 1st May – Sunday 5th

 

First day of the month is a Wednesday, so it’s the regular acoustic jam down the Southgate, Devizes, an open Mic at The New Inn, Semington or a live stream of the The Royal Opera: Faust at Wiltshire Music Centre, Bradford on Avon.

moonraker

Thursday 2nd jabs at your funny bone, when the Moonrakers Comedy Night sets into the Cellar Bar, Devizes. Ed Pownall presents headliner Sol Bernstein, returning after twenty-five years of semi-retirement, only playing nursing homes. He’s performed all over the world at venues including The London Palladium, New York’s Carnegie Hall, The Paris Olympia, Caesars Palace Las Vegas, and Scunthorpe Baths, but it’s at night clubs where Sol really comes to life. With opener, Craig Deeley, a finalist in Jongleurs Last Laugh competition, and an additional special guest, tickets are £10, available form: The Bear Hotel, Devizes Books, The British Lion, The Southgate Inn, The Vaults, and on-line at “We Got Tickets.”

Along with a Charity Quiz Night for the British Heart Foundation at The Owl, Bromham, Swindon’s masters of downbeat, slack indie and wobbly pop, the Flour Babies bring an acoustic set to The Tuppenny with support by Callum McLean. Meanwhile, Chapel Arts in Bath has Will Lawton & Weasel Howlett (feat Buddy Fonzarelli) with support by our favourite, Tamsin Quin; Devizine is the #officialtamsinquinfanclub

hopdog.jpg

The second ale, cider and sausage festival, Hopdog, at the Woodbridge, Pewsey, kicks off Friday 3rd. Three days of family mayhem for a £10 advanced ticket, £3 for 12+ and children under 12 free. You can camp, for £7, space is limited so please book early via email: woodbridgeinnpewsey@gmail.com Friday sees Grizzly & The Grasshoppers. Saturday: Bob Bowles, Brian Stone, Jazz Wrann & The Ruby Welts and Sunday, firm Devizine favourites, the Larkin boys will be with Fly Yeti Fly and Kit Trigg.

Another festival in Blandford starts, the Teddy Rocks, in aid of Children’s Cancer, with a tribute-based line-up: details here: https://teddyrocks.co.uk/

Over in Devizes, the family club has Hariana, the UK’s number 1 tribute to Ariana Grande, and rumour has it, Vinyl Realm will host another fantastic Drum n Bass night at the Lamb, unconfirmed as of yet. Melksham Assembly Hall boasts Jethro’s The Count of Cornwall tour, while the Neeld have Queen II, and Bradford’s Wiltshire Music Centre hosts the Orchestra of the Age of Enlightenment. But if you like it raw, the Back-Wood Redeemers are at The Royal Oak, Bath.

Star Wars Day, oh yeah, bank hols too, Saturday 4th May, it’s over to Urchfont, for the Scarecrow Festival; always a lovely family day, starts at 9:30 through to Monday.

borntorum

Saturday night in Devizes is about rum and reggae at the Wyvern Club, where Michelle and Stuart Field’s Muck and Dunder rum bar hosts Swindon’s finest SN Dubstation while you dip into forty types of rum, ah-ha me hearties, tenner a ticket from https://www.muckanddunder.co.uk/ or failing that, dependable The Southgate has the great Sunset Service, free as always.

Out and about, you only need to get as far as Seend for beer, yep, it’s that time again for the Seend Beer Fest, their 19th, they know what they’re doing; gawd blimey, Train to Skaville will be there; love them. Certainly, reggae filled weekend though, with The Bob Marley Revival headlining Melksham Townfest at the football club, with Falling Fish, The Decibelles and whaaaa???? Train to Skaville will be there too??; must be an express train. The Ultimate Stone Roses are at the Assembly Hall, over in Bradford on Avon the NYJO Ambassadors and Mark Armstrong are at the Wiltshire Music Centre.

townfest

Swindon has “kids for a quid” at the Swindon & Cricklade Railway, PinkMac at The Waiting Room and some groovy Disco Voodoo, with DJ Ashley Beedle at Baila Coffee & Vinyl.

Spring in the Park is a family fun-day in Warminster on Sunday 5th, or round up the weekend at The Southgate, with a band I’ve heard only good things about, The Astral Ponies. Swindon has the cool indie-sixties mod band, Six O’clock Circus at The Woodlands Edge, and Bath has Pigstock at The Pig and Fiddle; two stages, with Falling Fish, Pompadour, Cut Throat Francis, The White Lakes, Luna Lake, Jamie Watson, Eilis Tucker, and our own favourite, Mr George Wilding.


Week 2: Monday 6th May – Sunday 12th

 

Bank holiday innt? Those Devizes Lions have the May Day Fair in the Market Place, and Corn Exchange from 9am- 4pm. On similar lines as previous years, but in addition to trades and charities, a new class of stall is being introduced, for artisans who produce goods for direct sale to the public.

Sound Knowledge Marlborough are celebrating the holiday with a bang, with Frank Carter & The Rattlesnakes from midday in Club Thirty8, for a wristbands-only short set, after which they’ll be in the shop signing copies of new album ‘End of Suffering’.

Wednesday is acoustic jam at the Southgate. Thursday is regular Kinks tribute, Kast off Kinks  at the Assembly Hall, Melksham, but if you think there’s too many broken hearts in the world, head for the Cheese & Grain, yeah, yeah, I know; Jason Donovan.

Friday 10th sees Tom C Walker at the Long Street Blues Club, Teddy White Band returning to The Southgate, and legendary punk poet, Dr John Cooper Clarke at The Corn Exchange. English comedian and writer, Mark Steel gives contemporary rants with his Every Little Thing’s Gonna Be Alright show at Melksham Assembly Hall.

Sam Sweeney’s The Unfinished Violin at Wiltshire Music Centre, Bradford on Avon and Sharron Shannon Band & Seckou Keita at the Cheese & Grain, Frome.

a4poster[3646]

Saturday 11th start the day browsing the Stert Car Boot Sale, it’s Devizes Cancer Research’s grandest event, supported by Grist, please come and help make a difference to this invaluable charity.

presents1

In all actual fact, it’s a very charitable day in Devizes; yep, we’ve our first Devizine Presents gig at the Cellar Bar. If you like Larkin, then it’s a double-whammy, because while Fin and Sam will be there, it’ll be possibly the only place to see them both, separately, Sam with a newly formed band and Fin with cousin Harvey as the Truzzy Boys. If that’s not enough for you, The Hound on the Mountain, the incredible Jordan Whatley will also be showing off his new songs and Gail Foster I will be in charge of intervals with her spellbinding and, possibly, rude poems. It’s a fiver or whatever you can donate, in aid of Devizes Opendoor; so please come down.

Opps, UPDATE ALERT! Please see the poster above for a change in schedule, unfortunately Sam had to pull out, but every clown has a silver lifeboat, hurrah for sixties mod-rock covers band, The Roughcut Rebels, who’ve stepped in to save the day and will be sure to add an extra dimension to the festivities.

If my thing ain’t your thing, I might just forgive you, especially if you try the Devizes Town Band’s concert, “Greatest Love Themes,” which will be raising funds for Alzheimer’s Support at 7:30pm, The Corn Exchange. In a change from the traditional black, band members will be wearing some other colours to make the concert more dementia friendly. I can identify with this; my nan suffered this terrible ailment.

Some people living with dementia see a black mat or flooring as a bottomless black hole, which is understandably very scary. They can also see people wearing black as floating heads, because they cannot identify black clothes.

townband

Babs Harris, CEO of Alzheimer’s Support said: “People’s perceptions can change when they have dementia and it is fascinating to hear from some of them how they now see colours. It is so heartening that Devizes Town Band have taken this on board for their concert and taken this extra step to make their performance truly inclusive and dementia-friendly. It promises to be a wonderful evening of music and the bright colours will only add to the celebratory atmosphere.” Tickets are £7.50 and you can get them from Devizes Books, or online via www.devizestownband.com

 
Alternatively, Hip Route are live at The Southgate, and the brilliant Indecision at The Owl, Bromham.

 
In Marlborough The Skandals are at The Lamb and Room 101 are at The Bear. The Blue Rose Band at The Pilot, Melksham. London Mozart Players at Wiltshire Music Centre, Bradford on Avon, Operation 77 at The Woodlands Edge, Swindon. Martin Kemp’s Back to the 80’s at Cheese & Grain, Frome; take your own Rubix Cube.

 
For want a peaceful Sunday on the 12th the Marlborough and District Lions Club welcomes you to drive through the glorious bluebells at Westwoods, enjoy the Bluebells and help support your local Lions Club. This repeats again next Sunday.
Time travelling magicians Morgan & West present a jaw dropping, heart stopping, brain busting, opinion adjusting, death defying, mind frying, spirit lifting, paradigm shifting, outlook changing, furniture rearranging magic extravaganza at the Neeld in Chippenham Sunday afternoon, promising to be fun for ages 5 to 105.

 
That’s about it for the first two weeks of May, if you think it’s jam-packed you need to see the finale part of May’s what’s on article, which I’m working on now, okay – cut me some slack! But before I go, remember to check devizine.com regularly, as it’s updated, like, nearly every day, and you might well miss something.

 
Also, please shed my workload by letting me know about your event, or news stories; there’s only so much scrolling and clicking I can do. You can email your info to devizine@hotmail.com Tweet, message the Facebook page, or I now have a Facebook group called The Devizine Communications Group, to make it super easy to make me aware of your events and gigs and news and stuff, so use it, don’t abuse it, love it and get some free publicity for your efforts.

 
Most of all though, don’t whinge at me for omitting something if you haven’t actually told me about it, sounds bleeding obvious I know but you’d be surprised by that amount of people who do!

 

Hey, hey, hey; I have actually followed this article up, click the image to go to the rest of the month’s preview!

may

Adverts & All That!

abba26thgeorgewildingowla4poster[3646]0246075001556052475_plant-fair-poster-a4borntorumreggaenightost18thopendoorquiz0036273001555519004_outdoor training poster 20190941596001555518913_all stars flyerartsbarndancecurveballsgruffaloaveburyrocksericerniehauntedpostonceupontimevinylrealm

Wish You Were Here: All Floyd at The Bell By The Green

By Andy Fawthrop

 

Been a while since there’d been much live music on at the Bell, and the last tribute band they had last year had been pretty poor, so I hesitated before unlocking the wallet and extracting a fiver to get in. But we were back in business.

The place was packed and the band were in full flow.

floyd1

All Floyd are an 8-piece hailing from Salisbury and, as the name might possibly suggest, a Pink Floyd tribute band. Whilst I don’t go a bundle on tribute bands in general (a little voice inside me insists on wanting to yell “write your own bloody material” – but that’s another matter) I do have a bit of a rule on judging the quality of such acts. If you’re going to pay “tribute” to your heroes, you need to do one of two things – either re-produce their music extremely accurately, or else re-interpret their material in such a way that it really adds something new and interesting. However, the idea that you need, in any way, to look like your heroes, has little to recommend it. It’s music, not pantomime.

allflyod

Anyway, All Floyd went down the first path and made a bloody good job of it. Number after number turned out immaculately, note perfect, complete with backing singers and that wonderful, rich throbbing sound that Floyd fans will be familiar with. Messers Mason, Gilmour, Waters, Wright & Barrett would have been proud to hear their music so faithfully rendered. Close your eyes and they could have been in the room. They weren’t, but they could have been. In their place All Floyd are a bunch of very talented musicians and singers.

 

All the “hits” were there, including plenty of material from Dark Side Of The Moon, The Wall, Wish You Were Here, The Division Bell and many others. Not too much chat from the band between numbers, letting the quality of the music speak for itself. And there were some great moments too. Whilst you’d probably expect folks to sing along to “Another Brick In The Wall”, watching a whole roomful of people belting out “Comfortably Numb” was something quite emotional and remarkable to witness. Absolutely terrific. And after this I might even change my mind about tribute bands.

flyod2

Unfortunately the logistics of the Bell’s performance space didn’t allow for the full light show, but TBH I didn’t really miss it – the music alone was plenty good enough. However if you’d like to catch the band in full flow, they’re doing an all-seated version of the gig at Warminster Athenaeum on Saturday 4th May – might be worth a run out. Highly recommended.

 

Adverts & All That!

 

hilleggpresents10941596001555518913_all stars flyer0036273001555519004_outdoor training poster 2019artsbarndanceabba26thgruffaloa4poster[3646]georgewildingowlopendoorquizborntorumcurveballsaveburyrocksericernieonceupontimehauntedpostvinylrealm

 

Full Tone Festival

The Full-Tone Orchestra sing “Let’s do this, Devizes!” as they plan a Full Tone Festival in July. But they need your help….

 

The Full Tone Orchestra are putting on a festival of orchestral music in the Devizes Market Place on 20th July 2019, but need your help. Here they are, in their own words:

“Four concerts in one day, with acoustic support acts performing in between, and it’s going to be epic! We want to bring exciting orchestral music to the town in an easy and accessible way. We will have a massive stage, with a superb light show and there will be stalls to give the Market Place a real festival feel.

Wiltshire Council have already very kindly agreed to sponsor us half of the money, we now need to match this from other sponsors/donations.

We start with a family themed concert, The Fulltone Music School Choir will open it, then you’ll hear 50 strong orchestra play themes from Last Night of the Proms. Big, beautiful music in the centre of our town. Albert Hall, eat your heart out!

Our second concert is ‘Iconic Themes’ – epic music from films, ‘Star Wars’, ‘Lord of the Rings’, ‘Star Trek’, ‘James Bond’ etc. For those of you who came to our very first concert, you’ll remember it was mind blowing!

‘Classical Rock’ is up next with our friends from The Invitation Theatre Company (TITCO) joining us for a big ‘Queen’ set again – YES! Get in!

As the sun sets, we end with ‘Electronic Themes’, starting in the 1970s with ‘Chariots of Fire’ and ‘Tubular Bells’ moving right through the 1980s, ‘Popcorn’ might make an appearance, then into the 1990s where we turn up the volume and end in Ibiza! It will be utterly AWESOME!

All the musicians are donating their time we need to raise funds to pay for the staging, lights, sound and all the other bits you need to transform a town square into Wembley!

So this is where you come in – this is a free to attend event. But for it to happen we have to raise another £5000. We need to MATCH what we have already! So, whatever you can give, help us make this happen. Think of it, perhaps, as purchasing a ticket for the event. £5, £10, £20 – whatever you can afford or think your ‘ticket’ would be worth, please help.

Businesses, if you sponsor over £100, you’ll get your name on the poster! And we’ll thank you 100 times in all our press!

Punters, if you sponsor £20 or over, you’ll get a free festival T-shirt! What’s not to like?!

IT’S SO EXCITING! The town centre has never seen anything like this before! Help us make it happen!

Adverts & All That!

presents1artsbarndancefolddnbopendoorquizgruffaloa4poster[3646]curveballs0941596001555518913_all stars flyer0036273001555519004_outdoor training poster 2019georgewildingowlaveburyrocksabba26thericerniehilleggonceupontimehauntedpostborntorumvinylrealm

Introducing Devizine Presents; me getting out there and actually doing something!

Hi all, just a quick one from me today. I say that and then I waffle on; ah, you know me too well.

 
Learning lessons about event coordination this week I find it’s not as simple as it sounds. In all actual fact, it can be a bit of a headache. All those I chat with, wanting me to plug this, and that, well done you guys, I’ve experienced it from your side now! There was a point when I was like, yay; reggae in the Cellar Bar, then in one phone call it comes crashing down, and you’re left feeling now I got nought.

 
But spirits rising again, as from the failure comes two events, of which I’d like to run as a series; I dunno, bi-monthly or something. But I do want to blag what I can from our many venues and event coordinators, work with them to host some charity fundraising events, if they’ll have me and my shambolic procedures. But first, I need to thank everyone who’s overwhelmed me with positive responses to playing one of these, completely unplanned, disorganised chaos of events!

n2
Sam Bishop at our last outing in November. Photo by the wonderful Nick Padmore

So firstly, we kick off with an indie/acoustic type thing, down the Cellar Bar on 11th May. There, for a fiver, or, look, whatever you can chip in pal, you’ll find an abnormal assortment. Not that the acts are abnormal, but the line-up, for though you’ll know Sam Bishop and Finely Trusler as those indie lads from Devizes, Larkin, we’re hosting both of them, without any fights, hopefully, as Fin heads the Truzzy Boys with his cousin Harvey Trusler, and Sam, he’ll be with a promised new band.

truzzy.jpg
Truzzy Boys will be there, will you?

If that isn’t enough surprises, Melksham’s incredible, raw and energetic performer, the kind I’ve compared to a dreadlocked Jim Morrison in the past, will be there too. Jordan Whatley, aka The Hound on the Mountain, once member of the Compact Pussycat, returns as a solo artist with some new songs for us.

jordan
The Hound of the Mountain promises to fuzz us all up!

And we’re doing this for Devizes Opendoor, a registered homeless charity who’ve I’ve been to see first-hand the great work they do, providing a breakfast to kick off the day, lunch takeaways, clothes and books, but also advice, support and sociability for anyone sleeping rough or in sheltered accommodation. It’s a situation which never goes away, in fact increases, yet, with stereotyping and crass negative opinions, it’s easy to turn a blind eye to. Let’s not get all political, you know how I feel. Just know that this, and our second event will both donate all proceeds to Opendoor.

opendoorlogo
Click to read more about Devizes Opendoor

Wha? Second? Yeah, listen up, the reggae night, boomshaka-la, I did say, was merely postponed, and we should bash this one out too, the following week, same place, same time, on Saturday 18th May. Few bits to iron out at present, (and as you could imagine, I’ve an allergic reaction to ironing) but the man Knati P, and Raz-ah will be shaking the foundations of Devizes’ most prominent landmark, The Bear Hotel.

Look, don’t let me get carried away here, but we’ve a lot more on this to come, and I’ll let you know when it does. I’ve lots of acts wishing to contribute, from the incredible local acoustic Vince Bell, wonderful Sally Dobson, to some off the planet ska-punk, and much more. We’ve also a range of worthy charities to donate to, The Devizes & District Opportunity Centre are on my hitlist, along with the wonderful Arts Together.

 
Watch this space….no, bollocks to that, get yourself down the Cellar Bar on the 11th May, for what will be, I’m certain of it, a historic moment when Devizine ceases to become that crap you read online, and becomes actual, actually a darn good series of nights. Boom, that enough? Can I go now?!

 
Opps, nearly forgot; she’ll kill me, odds on bet. We will not, hopefully, leave you dangling in boring conversation about the weather during the band changeovers, no sir-y Bob. Our town’s wonderful, amazing, brilliant, Gail Foster will be drafted in to provide us with some mind-blowing, possibly a bit rude, poetry interludes. That is, if I’ve not annoyed her too much, see what I mean, it’s not easy being an event promoter; mine’s a Stowford Press by the way.

gailbook1

Here’s the Facebook event page, let me know you’re coming, because you need to come, tell me you will, but no fibs, do come! See, told you waffling, it’s not pretty.

 

 

 

 

Adverts & All That!

folddnbabba26thgeorgewildingowlborntoruma4poster[3646]artsbarndanceopendoorquizgruffalo0036273001555519004_outdoor training poster 20190941596001555518913_all stars flyerericernieaveburyrocksonceupontimehauntedpostvinylrealm

A Local Look at Knife Crime

Navigating my footing becoming trickier as guy-ropes criss-crossed my path midst the shadowy maze of tents, still I chased. For reasoning I need not go into, the pursued managed to grab two twenty-pound notes from my wallet, one of which I snatched back, the other he made off with. The fleeting moment had gone from bad to worse, at this huge, anarchic festival. Now I was alone, chasing this kid. He had encouraged me not to follow, threatened to “carve me up.” I doubted his word; “carve me up,” over a score?

The notion arrived at my frontal lobe when he abandoned escape, turned to flash a blade at me. It only registered once I was an inch away, and he took a swing with the knife, then, thankfully, I took heed of common sense; wasn’t worth twenty quid. I backed off; he ran. He got a note off me; sucks, but I kept my life.

Reminiscing this feels like a movie, you know, where the hero escapes with seconds to spare; utterly thoughtless to have taken it that far, there’s no reruns in real life, no alternative ending. I find myself contemplating the what ifs, in this era where knife crime is rife, so the media informs us. I stagger at the whole stupidity of it, worry for youth, in times of desperation, economic slump, taking to the streets armed is a sad reality.

To those who adopt this philosophy, look at my pitiful example of yore; you’re not a “playa,” not doing anything fresh, nothing gallant or outrageous, zilch “gangsta” pal, just foolhardiness you cannot, and will not see as such until you get wise, or on a hospital bed.

Least, I speculate, should think ourselves lucky in Wiltshire, where by comparison I believe the chances of being a victim of knife crime is way less. But how much less, and is it on the increase? What would happen to me if I was caught with a knife in Wiltshire? I thought I’d hassle Wiltshire Police’s PC Paul Woodbridge for answers. If you do take a knife out to play, maybe you couldn’t care less what the police have to say. Yeah, alright, you’re free to skip the interview part, but I beg you scroll to the conclusion under the line.

Now, the Salisbury Journal reported in January that Wiltshire is bucking the trend of increasing knife crime, and ours has gone down recently, The Swindon Advertiser ran a similar article, but back in April last year it reported precisely the opposite: “Stats show Wiltshire knife crime up 214 per cent in five years.” So, after an increase, it seems the rate is dropping locally. I asked Paul how this reflects on the knowledges of the police on the streets?

“I’m not sure where your stats come from but you may be referring to some PA figures released recently which show a hike between 2013 and 2018,” he explained. “If that’s the case then the explanation is that our recording of knife crimes has improved in that time along with more people coming forward to report such crimes, thanks to the increased publicity around this issue. Overall, our knife crime figures show Wiltshire is a safe place to live; the statistics show knife crime has dropped by 18% across the county in the past year (Sept ’17 to Sept ’18) but we won’t ever rest on our laurels, and will firmly deal with anyone who we find carrying a knife.”

knife3.jpg

The assumption is violent crime, particularly knife-crime is predominantly a city problem, how much better does our market towns like Devizes, Marlborough and Melksham compare to our larger towns and cities, like Salisbury and Swindon? “By the nature of population sizes,” PC Woodbridge clarified, “and generally speaking, smaller towns do not experience the same extent of crimes as larger towns and cities.”

Yet though I’ve been planning this article for a while now, only this morning a post on a Devizes Facebook group claimed their son was attacked by youth with a knife, and was cut across the face.

What would PC Woodbridge advise if you’re threatened with a knife? Or is this a no-brainer; I mean, I’d run, right? But what if you’re cornered? Does he think self-defence classes are a good thing? “As you said, the best advice is always to run and get help.” He continued, “get somewhere public where lots of people are, if possible, and call the police on 999. Self-defence classes are down to personal preference, but I would always look to put as much distance between me and the knife as I could.”

I wanted to gage PC Woodbridge on the wonky ethos of carrying a knife for protection, what would he say to those who do? “Statistics show that that those who carry knives are much more likely to be injured than those who don’t. Carrying a knife does not make someone safer and you will be arrested if caught with an illegal knife and not a good reason to be carrying it. You could then face time in prison.”

knife4

What about armistice in a town like Devizes? What would happen to you, what would be the process if you walked into the police station and handed over a knife? PC Woodbridge explained, “if you were to hand in a knife then we would take your details and provided there had been no offences committed, then it would be disposed of. Don’t forget in September last year we had a countywide knife amnesty as part of Wiltshire Police’s knife crime campaign, Op Sceptre, where up to 500 knives were handed in to police stations across the county and disposed of safely. We will plan other amnesties in the future.”

I asked him, what else can we do to raise awareness and promote knife crime safety? “Information and education are paramount. Our recent Op Sceptre campaign has been very successful. During a week earlier in March, we spoke to people and gave out leaflets to underline the message: ‘No knife, safer life.’ We also do a large social media and media campaign. Search for ‘Op Sceptre’ to see what was covered.”

“Op Sceptre may be over for now,” PC Woodbridge continued, “but our work doesn’t stop, we’re never complacent about knife crime and I want to remind everyone that we will respond to any intelligence and information given to us by the public; knife crime can affect anyone. We also continue working with schools and colleges to keep the safety and educational messages in the public domain.”

knife2
Wiltshire Police Website

 

So, that’s what the police said, but with all due respect to PC Woodbridge, and though I’m grateful for his time, I’d wager the ones we really need to reach out to have skipped past this, don’t care for the what the police have to say. So, I reply, okay, fair enough, for now, to hell with the police, it’s just me and you here talking, right? I don’t write like the standard press, out to make money. Readers expect an honest review, so I write from the heart. Take the start of this piece for example, journalists never open on a real personal incident, okay?

I know, understand and appreciate the world may’ve dealt you a shit card. Maybe your folks did a shit job at being parents, maybe you reckon this government are selfish, backstabbing bastards, and I’d say, yeah, you’re right, mate. Must be loads guilty for how crap your life is; but the thing is, it doesn’t matter who you’d like to point the finger to, when you choose to go out and take a knife, no one is to blame in that instance, but YOU.

It is your decision. If a government doesn’t want anarchy through poverty, why would it apply pressure through consistent service and educational cuts, when the magic money tree exists? I don’t know; maybe because it’s hidden in a walled garden. They pick it for funding war, bailing themselves out by buying votes, and lavish luncheons. I swear, it’s what they want you to do, takes the pressure off them. Channel your anger at them, see? By taking a knife to some kid who maybe dissed you out of tenner, may be shagging your girlfriend, or not paid you for that eighth, taking your frustration out on any Joe Bloggs, you’re playing into their hand. I’d even go as far as saying, alright, we live in the real world; bods mug each other off, and if so, if has to come to it, take it out with fisticuffs.

The vicious cycle is that you take out a knife, and they need to take out a knife, and she needs to take out a knife and everyone’s taking out a fucking knife. Break that cycle, or, simply, someone is going to get killed, if not you, them, but shit, you’re still gonna do time for it. That is pointless and damn right stupid.

Thank you to PC Woodbridge for his valuable time, I’m not one to say if this will make everyone stop and think about it, but if just one does, that’s one life saved.

 

Adverts & All That!

folddnbgeorgewildingowlabba26tha4poster[3646]borntorumgruffaloopendoorquizhauntedpostaveburyrocksericernieonceupontimevinylrealm

Made in Dagenham, Showy at Dauntsey’s

Under the circumstances perhaps the most thought-provoking character in the musical Made in Dagenham is wife of Ford Dagenham’s boss, Lisa Hopkins; through her own reservations about her plush lifestyle, the career-aspiring housewife convinces the female factory worker’s spokesperson, Rita O’Grady, that the campaign is one of sexual equality rather than a class struggle. When while the real Ford sewing machinists strike of 1968 did indeed trigger the passing of the Equal Pay act, the issue is quite clearly rooted in worker’s liberty too.

 
So, I bite the bullet and go against my principals, arriving at the prestigious independent school, Dauntsey’s, to watch The Devizes Musical Theatre’s production of Made in Dagenham on their opening night, yesterday. A private school who brazenly parades its charity status, aids a local primary school, does a few sports coaching sessions at others and then sails around the world on its private yacht. Yet the irony of a play with the theme of working-class struggle staged in this tax-avoiding loophole abiding school, which Theresa May pledged against in her 2017 Conservative manifesto, but soon after quietly dropped, seemed to soar clear over the heads of the audience.

dag2
And hey, who’d flunked it, the theatre there is rather luxurious in comparison to a comprehensive school hall. It served its purpose for this, rather splendidly arranged musical, which though received critical response, ending its run at the West End promptly, I enjoyed. Intrigue drew me to the performance, how one can produce a musical from this principled, true story based social-message film of the same name. That and the fact my upbringing lies in Essex, with roots from the East End, to the point of jaded memories of an aunt chasing me with a spoon of wobbling jellied eels.

20190411_155016
Yet it seems any movie is game for a musical adaption these days and for all that’s worth Made in Dagenham stages some apt, witty and intelligently written songs for the pivotal cast. The musical introduced some characters not in the film, of which the audacious bigot, cowboy Ford director was the most excruciatingly farcical, waving an electric guitar around like Peter Capaldi’s Dr Who car crash moment.

 
Though the script’s characters and content felt patchy at times, I loved the comical depiction of Harold Wilson, played brilliantly by Matthew Dauncey. It was almost pantomime-esque against the stern portrayal of Barbara Castle, acted equally radiantly by Laura Deacon. Yet the fourth wall remained bricked at all times. The moral as serious as the trade union’s dissolvement.

IMG_2724

Giving credit for its humorous components, my favourite by far was Rachel Ibbetson’s representation of factory worker clown, Claire; I guess it had to devote somewhat to the Essex girl stereotype. But mostly it remains ethically witty, rather than lambast a weak county pigeonhole. Though I felt the acting ability was varied, the aforementioned, plus lead roles of Lucy Burgess, Chrissie Higgs as Connie and Jon Paget were all fantastic in their acting and singing solos. A further credit must go to the children, Ivan Barter and Emily Noad, for their thoroughly convincing despair when the chips were down.

dag1

I did enter with intensions to jokily knock attempts at the Essex accent, and indeed many actors did purvey more West London pronunciation, yet trivial elements aside, I came out satisfied at a job well done. Particularly poignant was the orchestra, who played marvellously, if not overpowering on-stage dialogue at times. To nit-pick further, the production could have been tighter. The lighting felt limited, microphone moments of lapse, and severe feedback at times, we must overlook; this was presented as amateur dramatics at its best, and the motivation and love of the arts clearly shone through, to demonstrate a dedicated and worthy production. Yeah, box ticked my love, I’m off shopping in Chigwell, rightly portrayed as the San Francisco of Essex!

 
Made in Dagenham only runs at until Saturday, so I’d advise you drop into Devizes Books and hope they’ve still got tickets. Shows start at 7:30 with a 2:30pm Saturday matinee.

 

Devizes Musical Theatre

made in dage

 

Adverts & All That!

olivafolddnbgeorgewildingowlabba26thborntorumericernieaveburyrocksa4poster[3646]opendoorquizonceupontimehauntedpostvinylrealm

Orchestral Manoeuvres In The Dark: The Full-Tone Orchestra get Big, Bold & Russian

By Andy Fawthrop

 

Well – you can never say with any credibility that “nothing ever happens in Devizes”. Spurning the opportunity to listen to the Buddy Holly tribute in the Corn Exchange (even if just to watch Darren become young again), [I do read these Andy, just sayin’!- ED] The Duskers at The Southgate, and The Billy Walton Band at Long Street Blues Club, for reasons that may need to go forever unexplained, last night I found myself sitting in a church (yes – I know) and listening to a 48-piece orchestra. As you do. Something had happened to my musical sensibilities and I’d come over all classical.

The Fulltone Orchestra were in town, conducted by the wonderful Anthony Brown. The theme of the concert was “Big, Bold & Russian” and that was pretty well what we got. Culminating with Tchaikovsky’s splendid “1812 Overture” (complete with the sound of cannons firing – although no actual canons were harmed during the performance – and the crashing of cymbals), we were treated to several Russian pieces. Earlier we’d heard “A Night On The Bare Mountain” by Modest Mussorgsky, “In The Steppes Of Central Asia” a symphonic poem by Alexander Borodin, “Rhapsody On A Theme Of Paganini” by Sergei Rachmaninoff, and “Scheherazade” by Nikolai Rimsky-Korsakov. Quite a lot to get through, but the performance was excellent.

RUSSIANPOSTER

The acoustics in the church, with its huge roof-space, meant that the walls of the building fairly vibrated with the brass section in full flow, and the sound of the strings sailed up into the rafters. The noisier sections (famously referred to by Kenny Everett in his heyday as “the bash-y bits”) really took off in these surroundings. The quieter solo sections, however, suffered a little and tended to get a slightly lost at times. However, Dominic Irving’s pieces on piano really shone.

However, bearing in mind that that this is effectively a “scratch” orchestra, only brought together for this one night’s performance and after only about six rehearsals, and that this was the first time that all 48 musicians had been on the same stage at the same time, this was an incredible achievement. Our Tone had worked very hard to bring all this together in just a few weeks and, by and large, pulled it off with aplomb.

Two minor criticisms – it would have been nice to have a programme (so that we knew what we were listening to), and it would have been a good idea to give Our Tone a microphone – some of his introductions were lost to those of us at the back. But these little caveats aside, this was a great performance, a thoroughly enjoyable evening. It did exactly what it said on the tin – it was definitely Big, it was definitely Bold, and it was without doubt Russian!

We’re very lucky to have such an orchestra based in our town, and we really should get behind them and support them. Next up for The Fulltone is the Fulltone Festival in Devizes Market Place on Saturday 20th July, from 2pm to 10pm, where they’ll be giving four (yes – four!) concerts in one day!

fulltonenew

Adverts & All That!

made in dagehillegggeorgewildingowlabba26tha4poster[3646]olivaopendoorquizaveburyrocksericernieonceupontimehauntedpostvinylrealm

Buddy Holly Lived, Last Night at the Corn Exchange

I love the way BBC Radio Merseyside presenter, Asa Murphy says “Devizes,” in his Facebook video-diaries. The rich scouse accent feels almost alien against the usual Wiltshire enunciation. In fact, there was a scouse tinge amidst the customary folk chatter in the Corn Exchange last night, as it prepared for the hit show, Buddy Holly Lives.

Asa had messaged me early in the week, asking to give the event a push; he still had sixty tickets left. We did what we could, but I had to forewarn him Devizine’s demographic doesn’t trend to an older age group, generally. Also, it was perhaps the wrong weekend to stage anything rock n roll in town, both the Long Street Blues Club and the Melksham Rock n Roll Club had events, popularly enticing loyal target audiences the show would surely attract too.

IMG_2723

Yet my only inane grumble about last night was that we crammed into the Corn Exchange like sardines, the seats adjoined with paper-depth separation, left barely the leg-room of an Easy-Jet flight, as this massive hall was brimming to bursting point; seems virtually every remining ticket at the beginning of the week had been snapped up. While a younger crowd could cope with this, the nature of the show bound to attract an older crowd, who surely need just a little space to move, particularly being the show was absolutely spellbinding and enticingly danceable. You could feel the audience, of an average middle-age, being there were a few younger, itching to jump off their seat but fearful in their morals that they’d be shoving elderly neighbours to the floor.

Although the last thing I wanted to do was injure a kindly old lady with my frenzied twist, when Asa finally suggested we get up and dance, by pronouncing “we are still teenagers!” the crowd needed no more encouragement, and the finale saw old and young throwing away cares, qualms and perhaps, any medical advice against excursion, to dance wildly in the aisles and manage best they could in their space.

IMG_2719

If Asa also suggesting continuing the party into the Exchange’s basement nightclub in jest, had become reality, I’d wager this generation would show the younger a move or two! For rock n roll, agree or deny, doesn’t care, it doesn’t care if you reject its influence on every brand of pop which followed, and even if after this aged generation the songs of Buddy Holly was to fade away, his and his peer’s daring experimentation, hedonism and desire to fuse cultures will be the blueprint for everything which ever follows.

But maybe I’m getting ahead of myself, for Buddy Holly Lives is not a ground-breaking turning point for rock n roll, rather a homage to those that was, and for which was sublimely performed and thoroughly entertaining. Its narrative separated the show into four sections, recreating historic moments in Buddy’s career; his beginnings at KDAV radio which demanded he abstained current trends in rock n roll gave us a country intro, with a need to break the rules. Again, the resistance against shying away from playing the majority Afro-American Harlem Apollo and in doing so, giving Caucasians acceptance here, made an explosive second section leading to the interval.

IMG_2720

An inspiring third section a recreation of Buddy in the studio, enlightened his desire to experiment with strings and orchestral accompaniment, whereas the final section, though rather predictable, took the audience to the Winter Dance tour which saw the tragic end to this young prodigy’s life. Combined, Asa, backing group and associates acting the parts, gave us a comprehensive catalogue of Buddy’s songs and covers which Buddy would’ve approved, with panache and precision.

Rarely done with a “tribute act,” Asa tugged off trademark glasses and leapt out of character, to explain his reasoning for creating the show, the importance of bringing it to Devizes, and in doing so, not only introduced his charming charisma which has labelled him the “king of swing,” but paid a moving ode to Bruce Hopkins. It indicted the originality in this show, for though it had enough narrative to combine the songs, unlike a theatrical production, there was not enough to distract from the music, but more-so, this was not a tribute act, but a homage to Asa’s influence. It also stated the charitable donation the show made.

IMG_2722

In conclusion then, the combination of the show’s charitable cause, the reasoning for producing it, the subtle but significant narrative, the band and Asa’s realistic, vivid and skilful recreation of the legend of Buddy Holly and the Crickets, made this show absolutely brilliant.

Adverts & All That!

made in dageolivaabba26thborntoruma4poster[3646]curveballsopendoorquizgeorgewildingowlericernieaveburyrocksartsfestdevonceupontimehauntedpostvinylrealm

The Cellar Bar goes Subterranean with Falling Fish, Larkin and Clock Radio

Andy Fawthrop  is Getting Down & Dirty with Sheer Music’s Second Subterranean gig down the Cellar Bar last night……

 

These sessions are named “subterranean” because the venue is underground, and Sheer (yea, for it is they) have always represented and supported roots, underground music (geddit??). Anyhow, having missed Subterranean #1, we were damned determined not to miss this one. Good decision – we were well rewarded with three great offerings.

Falling Fish were first up – a young band from Bath. Once I’d got over the shock of realising that none of them looked old enough to get served at the bar, I came to the conclusion it didn’t make a blind bit of difference, as this four-piece proceeded to knock of our some driving, dirty indie rock. Whilst admiring their chutzpah in turning the amps up to 11 (stadium level), I thought it might have been useful to dial the sound down a bit more to Cellar Bar levels. Still, once they’d finished blistering the paint from the walls, we got an extremely competent and tight set. Loud, proud, good stuff.

sub3

Local favourites Larkin were next up. Last time I saw Sam and Finley they were surrounded by other musicians at the launch event for their EP at the Con Club, so it was great to see & hear them deliver a more stripped-back set. This allowed the quality of their songs to shine through, and their playing to come more to the fore. They looked and sounded so much more confident. It’s great that they can play in both formats, but I think I slightly prefer them as a simple duo. They’ve got some good songs under their belt now, and it’s great to see them working on more new material.

sub1

And finally to the Grand Old Men of the evening – Clock Radio. And they didn’t let us down. A great, full sound, very much driven by the intense drumming of Gary Martin. Some fast and intense material, with a good, tight delivery. Last time I heard them was a couple of months ago at The Southgate, but the Cellar Bar as a venue seemed to suit their sound a lot better. They looked as though they were letting themselves go, and really enjoying the experience.

sub4

Went home one happy bunny – but it was a great disappointment that more people didn’t turn out for the gig. Such a shame that the promoter goes to such efforts to assemble such fantastic line-up, and finds three bands prepared to deliver some great performances, only for the Cellar Bar to be half-empty. If you weren’t there, you missed a great gig. Please support future gigs and live music! Come on Devizes – you can do better than this!

And just a word to the management of the Bear/ Cellar Bar – it’s bad enough only having Waddies excuse-for-beer without serving the stuff in flimsy plastic glasses. Not a life-enhancing experience!

 

Adverts & All That!

buddyhollylivesknati6tha4poster[3646]curveballsopendoorquiz51777752_2012580512128525_7993299459184263168_naveburyrockssaddlebackfriolivaericernieonceupontimegeorgewildingowlmade in dageborntorumhauntedpostabba26th

April Showers with Stuff to Do….

Birds singing, the blossom on the trees, and that first cut of the lawn (groan!) Spring is here and it’s time to venture out and about, without snood and snowshoes. This summer sees some great events and gigs, but what’s on offer this early? Let’s take a look at what’s to be doing this April.

It’s always worthwhile heading to the Southgate in Devizes on a Wednesday if you like acoustic music, you’ll discover regular acoustic jam sessions, where any of our great local musicians may just turn up and improv.

But this Wednesday 3rd, there’s also open mic at New Inn Semington, or the Lamb in Devizes hold their fourth vinyl listening night with Pete from Vinyl Realm. From 7:30-9:30pm you can join this social gathering with a log fire and nibbles. Take your favourite album along to play and natter about all-things music with other vinyl lovers. It’s free, nibbles too, and they’ve a raffle.

If you take your kids anywhere this weekend, Horrible Histories is touring and at The Wyvern from Wednesday to Sunday 7th, with Terrible Tudors / Awful Egyptians.

sub2.jpg

For a fiver a pop, the weekend kicks off on Friday with Sheer Music back down the Cellar Bar for the second in a series dubbed Subterranean. Young indie band Falling Fish and Devizine favourites Larkin support Clock Radio. Meanwhile there’s raw roots blues with the king of cigar box guitar, Howlin Matt down the Southgate. But if you want to get dancing, it’s good to hear house music returns to town, it’s Funky Sensation’s launch at the Exchange with DJ’s George G-Force, Nina LoVe and Stach; preview here.

funky sensation2

It’s also good to see People Like Us returning to their former place of residency, The Waterfront in Pewsey, while George Michael fans need to head for the Assembly Rooms in Melksham for Fast Love and lovers of a golden era of music from the 1920s and 1930s need check out the Pasadena Roof Orchestra at the Neeld, Chippenham.

But most eyes focus on Swindon, ska fans in particular, with The Erin Bradwell Collective at the Castle and Ska-Bucks at the Vic, but also, their Fringe Festival begins. Running from Friday 5th to Sunday 14th, there’s a truckload of variety across Swindon’s finest venues, from the Groovy Pig Festival, and our friends at The Ocelot with their regularly hosted comedy nights at The Vic, to bizarre theatrical performances at the Artsite, The Olive Tree Café, and nerdy night of action figure archive show, After Dusk: An Improvised Twilight Zone at The Incredible Comic Shop. Check out the website, too much to list here!

RUSSIAN%20POSTER.png

Saturday night is owned by Devizes, with the Billy Walton Band at the ever-popular Long Street Blues Club, The Duskers live at The Southgate and of course, The Full Tone Orchestra are at St Johns being Big, Bold & Russian. That said, I’m cannot wait for I’ll be at Asa Murphy’s Buddy Holly Lives show at the Corn Exchange, in honour of Bruce Hopkins, oh boy, this’ll be a knockout; preview. (Apologies, terrible pun, could’ve at least pre-warned you!)

buddyhollylives

But rock n rollers are spoiled for choice Saturday as Melksham Rock n Roll Club brings us The Hurricanes at the Spencer Sports & Social Club from 7pm. while Local Heroes Inc at The Jenny Wren in Calne, and Port Erin at The Lamb, Marlborough also come recommended, rum n reggae fans need to head for Wotton Bassett, where Razah-I-Fi and Knati P are blasting some sound system culture at the Cross Keys.

knati6th

Sunday is Devizes Half Marathon and Fun Run, I’m certain “fun-run” is an oxymoron, but c’est la vie! Be Well, a Holistic Wellbeing & Spiritual Event is at Corn Exchange, but I’d consider PSG Choirs for Alzheimer’s Support @ The Neeld, Chippenham.


 

April’s Second week sees the highly-anticipated production of Made in Dagenham by The Devizes Musical Theatre at Daunstey’s. Running from Wednesday 10th to 13th, this uplifting British musical comedy about friendship, love and the importance of fighting for what is right is inspired by a true story and based on the hit movie, Made in Dagenham. Book a Ticket here.

made in dage

Friday 12th is all about Sheer Music’s favourite American, Olivia Awbrey down the Cellar Bar of the Bear, Devizes. To be honest, Saturday looks rather quiet, so far, Fret ‘n’ Keyz are at The Southgate while country fans will enjoy Zenne and Shooting the Crow at the Cavalier.

oliva

Meanwhile Marlborough’s Sound Knowledge celebrates Record Store Day. This year’s list is available online: https://recordstoreday.co.uk/releases/rsd-2019/ They’ll be open from 8am with hundreds of titles from the list. Get in touch with Sound Knowledge and let them know what you’ll be hoping to pick up on the day, they cannot reserve anything, but it insures correct ordering. The fun continues on Sunday, with an amazing live music roster from midday, including The Leisure Society, LION, Tom Speight, Little Geneva, and Wilding. It’s free entry, and has a Bar and barbeque.

Melksham’s newest pub, The Hiding Place hosts song-writing and touring legend, Henry Priestman, a founder member of punk band Yachts in the 70s, and The Christians in the 80s. This is at The Rachel Fowler Centre in Melksham, the venue is so beautiful and yet few people even know it’s there. £10 per ticket, can be bought at the bar in The Hiding Place or over the phone. Eighties soft metal fans meanwhile could take in Bon Jovi Forever at the Assembly Hall.

Swindon also has a metal tribute on Saturday, with Whole Lotta DC at The Vic. But if you’re over that way, I cannot recommend the Boot Hill All Stars enough, they’ll be with Monkey Bizzle at The Rolleston Arms. But if you want to take your kids raving, you know, show them how you did it, Raver Tots return to Meca with Nicky Blackmarket.

Pongos-Party-website-crop-1024x417.png

If you’d rather not thrust your bad habits at your children, grab a £10 ticket to the Neeld in Chippenham on Sunday, when it’s Pongo’s birthday party! A colourful farmyard is the setting for these loveable puppet characters; Pongo’s Party is a family show particularly suitable for 2 – 7-year olds, and includes a special guest appearance by the Easter Bunny!

If that all seems a tad too much, adults could try cross-border folk multi-instrumentalists and festival favourites, The Shee at the Wiltshire Music Centre, Bradford-on-Avon. An exceptional all-female band boasting powerful and emotional vocal performances and instrumental prowess.


The third week of April sees another Devizes Books Presents event on Wednesday 17th. The theme is Shopping! Women are supposed to love it, men to hate it. Both have written about it. Hear India Knight on its joys, G.K Chesterton on how much he hates grocers, and Sophie Hannah on what she got up to in bookshops. Much more, including Dalgit Nagra, Bill Bryson, Fanny Burney, Evelyn Waugh, Radcliffe Hall plus a guest appearance by a local poet, (that our man, Andy?) 7 for 7.30 Tickets £6 to include a drink and nibbles. Over in Swindon, the Wyvern have a Celebration of eighties soul idol, Luther Vandross.

allflyod

Thursday 18th rock fans could try The Sultans of Swingers @ The Bear Hotel, Chippenham, while space rock fans head to The Bell by The Green, Devizes for Pink Floyd Tribute, All Floyd; it’s a fiver on the door. BUT -If you missed Little Geneva’s album launch at the Cellar Bar in March, or you’re just in Marlborough and thinking, I want some raw, passionate blues, Little Geneva are at Club Thirty8, tickets are a fiver too, and you get the incredible George Wilding supporting.

littlegenvafeat

Ska fans point your boots and braces in the direction of Swindon, where the Erin Bardwell Collective play to their home fans at Beehive before heading for the London Ska Festival. That or, Vic Fest 2019 at, The Vic, where else?! Mod and scooterist fun continues on Friday when the Exit 17 Scooter Club do an Easter egg run, with local sixties garage band, Absolute Beginners at the Consti Club afterwards.

d&B1

In Devizes town Honeytrap return To the Southgate, and Vinyl Realm Presents their second drum & bass come house bash at The Fold in the Lamb, with Harry B (Gyro Records) James Threlfall (Mini Rig) and Rappo (b2b/Retrospect.) These nights are quite exclusive, with 50 fiver tickets for each event, 30 spaces on door, but fear not, for Saturday they’re doing it again with a house/trance night with DJ’s Rappo, Morgosis and Shaun Ashley of Rapture recordings.

You haven’t got to go raving though, people of Devizes; Sam and Finley are back together as Larkin Live at the Southgate, or Katy Ellis is at the Devizes Family Club in the Cavalier donning two tributes, Katy Perry and Taylor Swift.

Easter Sunday book your kid into the Hillworth Park Easter Egg Hunt quick, as it’s limited, and at £3 at pop, going to be popular. Adults hide away in the Three Crowns with People Like Us. If contemporary reggae is your thing, try Reggae Wiltshire’s Easter Sunday Reggae night at The Skybar Melksham Football Club; Reggae, RNB, Soul & Ragga mixed by Reggae Wiltshire’s exclusive DJ Mister M.

hillegg

Of course, Easter will flow over to Monday, and where better than the Southgate, Devizes where Nuages Gypsy Jazz play some, well, gypsy jazz I’m guessing! It is also the opening night of Andrew Bovell and Freddie Underwood’s Things I Know to be True at The Wharf Theatre, running until Saturday 27th April.


All is rather quiet while we digest our chocolate eggs or else spew them up on mum’s fluffy white stair-carpet. Friday 26th April then, Devizes has King Louie at The Southgate, while The Cavalier have Abba tribute, Abba’s Angels, and its Open Night at the Pump in Trowbridge.

abba26th

Renowned Sculptor Fernando P Saenz exhibits at Wine St. Gallery, Devizes from Saturday, and the quiet period crashes down. George Wilding down The Owl in Bromham, the incredible Nerve Endings blast out down The Southgate, and All That Soul returns to the Devizes Scooter Club, after a sell-out show this time last year.
allthatsoul2newvtext

Out of town, The Delray Rockets are at the Melksham Rock n Roll Club, it’s Buckfest at The Roebuck, Marlborough, the Chippenham CAMRA Beer and Cider Festival at The Olympiad Leisure Centre and the Long Arms Music, Cider & Beer Festival near Steeple Ashton. Dylan & Igor @ Wiltshire Music Centre in Bradford on Avon and Swindon has Shepard’s Pie at The Vic and Complete Madness at Level III.

There’s a tribute to Alfie Boe and The Musicals at Devizes Family Club in the Cavalier on Sunday 28th, and wind down the month at The Vaults with a Tapas Night on Monday, or April Lightgarden at Bradford Folk Club on Tuesday 30th.

Before you’ll know what’s what it’ll be May, with the Devizes Lion’s May Fair, Hopdog Fest at the Woodbridge, Urchfont Scarecrow Festival, Born to Rum at the Wyvern Club Devizes, The Seend Beer Festival with Train to Skaville, Melksham TownFest, All Roads Lead to Frome at Cheese & Grain, Chippenham Soap Box Derby, Shindig Festival, Chippenham Folk Festival, Lechlade Festival, OwlFest, and loads more from the Coopers Hill Cheese Roll to Jason Donovan, yes, Jason Donovan at the Cheese & Grain, and when you’re done with that, it’s Devizes Arts Festival. Keep one step ahead with Devizine, continue to scroll the home page where events are added, like, nearly all the time!

 

Adverts & All That!

 

vinylrealmonceupontimeborntorumhauntedpostcurveballsaveburyrocksericernieolivaartsfestdevsadleback-blues-festival-logo-2019

Things I Know to Be True at The Wharf Theatre

 

Ever since Little Shop of Horrors, the things I know to be true about The Wharf Theatre are that, it’s a lovely, unpretentious theatre Devizes should be proud of, and it’s dedicated to bringing quality shows to our town.

Written by Andrew Bovell and directed by Freddie Underwood then, The Things I Know to Be True is their latest offering. It runs from Monday 22nd to Saturday 27 April, curtain at 7:30pm, and despite being a relatively new piece, its first UK production in 2016, it is already on the GCSE syllabus.

Claiming to be an inspirational compliment of text and movement, Things I Know to be True is as beautifully touching as it is funny, a portrait of marriage and family as seen through the eyes of four siblings, Pip, Mark, Ben and Rosie, all of whom have their own struggles and secrets.

Bob and Fran Price have worked hard to give their family all of the opportunities they never had and now, with their children ready to fly the nest, it should be their time, a time to sit back and smell the roses. But a change of season brings some shattering truths as reality is tested and lives are redefined.

Tickets (£12/under 16s £10) can be purchased from Ticketsource at:
https://www.ticketsource.co.uk/the-wharf-theatre/events or at the Devizes Community Hub and Library on Sheep Street, Monday to Friday, 9am-5pm or by ringing 03336 663 366.

To find out what else is on at the Wharf pick up a new Spring/Summer brochure which is now available from the Community Hub and Library and many other outlets around Devizes.

wharflogo

Adverts & All That!

buddyhollylives

aveburyrockshilleggabba26thericerniejamieowlonceupontimeSpring concert POSTER 2019. C.inddmade in dagehauntedpostborntorum

With A Little Help From My Friends

Tamsin Quin and Friends; Friday 22nd March at The Southgate, Devizes….

By Andy Fawthrop

 

Nothing quite warms the cockles of your heart as much as attending a local, home-town gig featuring home-grown talent, so Friday night up at the Southgate was a real treat.

Tamsin Quin has been going great guns lately, having recently supported the amazing global artist Beth Orton in Frome, and also one of this generation’s best female blues singers Kyla Brox at Long Street Blues Club. Not to mention the recent release of her new album “Gypsy Blood”.

P1000360.JPG

On Friday we were treated to a warm, intimate set in the friendly surroundings of The Southgate. Tamsin was relaxed, chatting freely to the audience, including her many friends. But there were friends up on stage too, performing in various solo slots and band combinations, in the shape of Pat Ward, Vince Bell, Jamie R Hawkins and Phil Cooper. The songs flowed, the beer flowed, and it was difficult not to feel the love in the room.

Another great gig listening to a young artist on top of her game.

Next gigs coming up @ The Southgate:

• Friday 29th March Jack Moore
• Saturday 30th March Beyond The Storm
• Friday 5th April Howlin’ Mat
• Saturday 6th April The Duskers
• Friday 12th April Broken Bones Matilda
• Saturday 13th April Fret ‘n’ Keyz

 

Adverts & All That!

 

vinylrealmSpring concert POSTER 2019. C.inddwellyfestjamieowlbuddyhollylivesabba26thericerniemade in dageborntorumhauntedpostonceupontime

Little Geneva take the Cellar Bar hostage for the Night

Little concern, Little Geneva fulfil expectations down the little Cellar Bar last night……

 

 

Awoke this morning and, on BBC Breakfast, witness middle-aged folk pulling themselves through an underground tunnel on a wheeled tea-tray, replicating the great escape on its anniversary. Unless you were there, or you’re Dr Who, you’ve no hope of comprehending the ambience of a smoky cavernous club at the eve of the early sixties British blues detonation any more than understanding the anxiety and fear to be levering through tunnel Harry to escape the prisoner of war camp.

 
Retrospective is big business, Hollywood ran out of ideas a decade ago, but replication is often forged and not without cliché. Yes, you could succumb to the paisley tribute act scene, or pay a king’s ransom for a blues legend in concert, but it’ll not capture the spirit of the era, or the artist in their prime. As generations roll genres gain acceptability, and the contemporary blues scene, though thriving, tends to centre around matured audiences, weary of intoxicating themselves and reluctant to shake a tail feather.

 
Yet if I squinted my eyes in the Cellar Bar last night, and allowed the music to flow through me, I’d be forgiven for pondering what it’d have been like to wander into a squalid nightclub in 1963 to hear The Animals, Kinks or Faces at their early stages, considering this is a close as I’m going to get.

 
I nod in appreciation that Little Geneva has simulated this, without cheesy or elderly representation. For this Bristol-based band with roots in Devizes aren’t here for pretence, this debut night is not passé, or deliberately treated with “tribute,” it is just a young band stripping back a sound to its raw roots, and thoroughly enjoying the attention it fashioned.

littlegenvafeat
It was the most crowded I’ve ever seen the Bear Hotel’s dungeon-bar, Sheer Music’s sell-out show breathes life into the promoter’s quest to retake its hometown, after successfully branching to larger towns over hill yonder. It’s like punk never happened down there, like The Who time-travelled and waltzed in, spontaneously agreeing to perform. From its off, the band chilled the expectancy in the atmosphere with a smooth vocal and percussion mallet drum solo, akin to Jim Morrison’s spellbinding moments, which hypnotised crowds of acid-tripping hippies.

 

 
Yet this had not occurred before, armed with just acoustic guitar, Jon Amor done his thing, and done his thing as proficient as to be expected by locals. The Devizes legend as support, soothing blues, acoustically covering songs from his latest album, Colour in the Sky, with residential witticisms like obtaining a 1am chicken burger from the Market Place. It is always an honour to witness Jon, as a New Jersey resident’s admiration for a Springsteen gig.

 

lg2
This was raw, energetic blues-rock at its best, Little Geneva not covering known songs, least no classic immediately recognisable, just celebrating work done on their album, Eel Pie, in this explosive launch party; an awesome night, making the high bar prices at the Bear inconsequential, it’s a bucolic, rustic cavern of quality.

 

lg
If anything, I find myself reflecting on my father, for the sixties was his era, and common banter in our family that he was in an amateur band. Mocked by my mother claiming “they were rubbish anyway,” and my father’s shunning, suggesting, “everyone was in a band back then, it was just a trend,” it’s only now occurring to me if it really meant something more to him, hanging up his guitar to dedicate his time to being “Dad.”

 

 

Something I can only speculate, wishing I’d have had the opportunity to question him about his feeling towards it. Yet, it reflects the trend today, least I find locally, whereby twenty-somethings are taking to an instrument purely for the love, absent of my generation’s slouch into technology-driven repetitive beats. If there’s a growing trend for this, Little Geneva perhaps hold the belt now, and hold it under the influence of all which went before, but not in a contemptuous, plagiarising or cheesy method, but a renewed, lively manner.

 

 

So, if you missed this last night, I’d thoroughly recommend you track them down: April 14th for Record Store Day at Sound Knowledge, Marlborough, April 18th at club Thirty-8, also in Marlborough, and April 15th at St James Wine Vaults, Bath.

 

Adverts & All That!

Spring concert POSTER 2019. C.inddwellyfestjamieowldecontonicposterbuddyhollylivesmade in dageabba26thericernieborntorumskaingsheepScooterRallyposterNovonceupontimehauntedpostvinylrealmstove1

Over Boot Hill to the Southgate

With the distinctive odour of stodgy crusty nourishing the air, the Southgate Inn Devizes jam-packed once again, this time in anticipation of a plentiful tequila-guzzling gang, breakneck banjos, and feathery lunacy, under the banner of those Boot Hill All Stars.

 
If there’s a band in the area I’ve been meaning to check out more I’d favour you remind me of them.

 
Okay, so I’ve put these nutters on a pedestal prior to catching them play, but the perilous move paid off; they were everything I imagined they’d be, with added professional folly. A canal-type’s darlings, talk in the rain-drenched beer garden consisted of various motors, otherwise was the sort of crisp banter you’ll only receive from these waterway travellers.

IMG_2717.JPG
Truly the worst photos taken for Devizine; accept no subsitutue

In which case, The Boot Hills couldn’t have been more apt for the Southgate, its proprietors rightly proud of their canal culture; these guys know how to have fun by the boatload, and fun it was. One chick down unaffected the mob, but not before a duo self-titled “Dry White Bones,” astounded the tavern with a unique blend of fiery folk with guitar, bowler hat, doc Martins and claves.

 
Fast, furious but friendly, The Boot Hills squeezed into the tight space and dancers wasted no time to celebrate their inimitable sound of misfit folk-fused rockabilly, gypsy-ska and general nuttiness. Sporting banjo and quiff, Flounder, composed the group, for want of a more appropriate word, and Cerys titillated with either tambourine or fluffy stick in a sturdy corset and top hat.

boothill2
If their own compositions didn’t feverously fire the crowd enough with tales of female masturbation, a cover of Toot’s Monkey Man certainly did, but most poignant was the scorching dissolute interpretation of Dolly’s Jolene. Phew, I’m flabbergasted, it was a filthy fuelled show of dubious ethics and warped values, and with a support résumé as varied as The Damned, The Beat to The Wurzels, it’s easy to see these misfits actually do fit, and what is more, bring the party with them.

IMG_2716
What? They had zider….

Favourites on the festival circuit of Glastonbury, Camp Bestival, Endorse, and Boomtown, for the best part of ten years, but who’d count? They hold the Once Upon a Time in the West, a festival which adopts their insane ethos, and if last night was anything to go by, expect this to go off.

 
It’s the sixth year of this festival, with a reputation of one of the friendliest and most accessible festivals on the circuit, it offers variety as diverse as punk, dub and ska, with the likes of Urban Lions, and The Tribe, to Corky’s devious blend of agricultural hip hop, he dubs Scrumpy & Western, oh and to ensure it’s a true west country welly-fest, the Wurzels also booked. Personal favs, Train to Skaville and Phil Cooper appear too, amidst a boundless line-up. Tickets on sale now for £85 here.

 
Akin to the opening of US sitcom Cheers, The Southgate continues to be that place sometimes you need to go; where everybody knows your name and always glad you came. Celebrating a year now at the helm, Deborah and Dave have successfully given birth to a live music landmark right here in our otherwise trivial town.

 

Adverts & All That!

white_horseonceupontimed&B1familydiscowellyfestSpring concert POSTER 2019. C.indddecontonicposterjamieowlbuddyhollylivesmade in dageericernieScooterRallyposterNovsadleback-blues-festival-logo-2019directoryheadervinylrealm

The Lamb gets Drum n Bass

I reminisced about Devotion at Golddiggers last week on our homage to Keith Flint, don’t intend to go there again. But, (it’s a dirty big fib, you know it is…) I’ve been contemplating once, in the early nineties, inactive in my car in the carpark, when, what can only be described as “a cheesy raver,” completely unbeknown to us, steadied himself on the rolled-down driver’s window and allowed their jaw to run a marathon. He jabberingly informed he had no intentions of going back into the club, in his own words, “it’s all that jungle music, know what I mean?”

diggers1.jpg
Pop Quiz: Who can tell me what this was, and what it was for? Showing your age now whistle posseeee!

To be honest, I didn’t, it was the first time I’d heard it called by this name. Although, breakbeat had taken over acid house and techno “bleep,” the “hardcore” label was preliminarily splitting. X-L Recordings, albums like The Rebel MC’s Black Meaning Good and Ragga Twins, Reggae Owes me Money, were providing the hardcore scene with reggae-inspired beats which would assist the divide. Generally, many white youths headed for crashing pianos, hi-hat loops and sped up eighties pop samples, defined as “happy hardcore,” while the urban minority bought us a shadier, serious arrangement of sparse beats and deeper basslines, we now know as drum n bass.

 

 
At the time we considered ourselves maturing ravers, (oh, the irony!) The upcoming generation separated the two, we buried into a new wave of plodding house. Yet with one eye on the divide I appreciated the lunacy of happy hardcore, enjoyed its merry ambience, but couldn’t help feeling drum n bass held the future. It was the more creative and experimental; proved right in the space of only a few years; A Guy Called Gerald, Goldie, and LTJ Bukem were pushing its boundaries into concept albums like it was 1975 space-rock. They prepared the stage for Roni Size, and mainstream acceptance of the genre.

 
So, I had to chuckle at the premise of the blurb on the Facebook event page, where Vinyl Realm stages a drum n bass night at The Lamb, Devizes on the 23rd March with DJ’s Retrospekt, Rappo and Harry B. “We at Vinyl Realm feel there is nothing in town for young adults to do. So, to fix that we have a night dedicated to the local producers creating heavy DnB, deep House and banging Jungle music.”

d&B2

Hey, what about us middle-aged old skool ravers? I can still shake a leg yer know, still got it mate! And when I say old skool, I don’t mean like on Kiss FM when they blast a club anthem from 2006 and think they’re retrospective; we were there, at the beginning pal, stomping in the mud! We fought an oppressive government so you kids can rave!!

 
But yeah, you’re probably right, I’d only be panting disproportionately and holding onto the wall for dear life, or else chewing some kid’s ear off about how we used to do it, like Uncle Albert on a love dove. Best leave it to the younger crew. All jokes aside, I know Devizes D&B DJ Harry B has posted to Facebook in the past, attempting to gage interest into such a night.

d&B1

I fully support the notion, good on the organisers of this, they’ve hit the hammer on the head; there’s nothing of this genre in Devizes, and not a lot for young adults; fair play, I hope it goes well and spurs others to provide entertainment for this age group. Seems like it will, limited to fifty tickets, with forty showing interest on the Facebook event page, this will be an exclusive return of D&B in Devizes which you better get in quick on, if you’re a playa. A snip at a fiver, tickets are on sale now at Vinyl Realm.

 
I just hope the old pub can hold up under the pressure of devastating basslines! I put my concern to Harry. “I’m going to have a test run up there this week with the speakers,” he confirmed; storming!

 

Adverts & All That!

vinylrealm

onceupontimeknati6thjamieowlfamilydiscoScooterRallyposterNovmade in dageborntorumstove1

Feeling the Force of The Devizes Arts Festival

If there’s a stigma among the typical denizen surrounding the Devizes Arts Festival that it’s all rather pompous and geared toward the elder generation, all walks and organ recitals, and that sounds like you, then I bid you look closer at this year’s newly announced line-up.

logo-e1550603767970.png
Devizes Arts Festival has pulled a colossal rabbit out their hats for this June’s festivities; really, I don’t know where to begin. Yes, some of it conforms to the customary Arts Festival bookings, such as an audience with international journalist and veteran reporter John Simpson (Corn Exchange. Friday 31st May) and an organ recital by the Sub-Organist at Durham Cathedral, Francesca Massey (1st June St Johns.) There’s even a two-hour festival walk; Historic Devizes (2nd June. Devizes Town Centre,) guided by experts from the Wiltshire County Archaeology team, and a Civil War Battlefield walk at Roundway Down on 9th June.

 
Now, don’t get me wrong, while there’s no bad about any such events, and chatting with organiser Phillipa Morgan, who is keen to point out, “we had fifteen sold-out events last year,” there’s many-a darn good reason to cast off this erroneous label.

arts1.png

I assure, many acts are set to blow some interest in the direction of those who’d not considered the Arts Festival before. Ska, for instance, (you know me, fancy picking on this one first!) with Skamouth favourites, Coventry’s (the home of Two-Tone) Barb’d Wire (1st June Corn Exchange) who boast legendary and original rude boy himself, Trevor Evans, combined with local songwriter/singer Lloyd Mcgrath. This is certain to raise a few eyebrows; perfect for the 40th anniversary of Two-Tone.

untitled

You can zip your soul boots too, for seventies pioneers in funk, The Real Thing are confirmed, (8th June. Corn Exchange.) Known for legendary hits “You to Me Are Everything” and “Can’t Get by Without You,” Devizes is sure to feel the force!

 
Wiltshire’s own Nick Harper is at The Exchange, 13th June, contemporary Congolese and Cuban music 15th June at the Corn Exchange with Grupo Lokito, and experimental prog-rock with CIRCU5 (16th June. Cellar Bar.)

grupo-lokita2

The brilliant radio, television and stage comedian Ed Byrne (12th June. Corn Exchange) was the other to immediately catch my eye. Joined by special guests, David Haddingham and Sindhu Vee, this one promises to “have you rolling in the aisles.” With sold-out runs at the Edinburgh Fringe, and the West End, it reminded me of a conversation I had with some organisers last year, about how they travel to Edinburgh to source acts for the Arts Festival. This dedication has paid off, it seems, and we’re set for an explosively good year.

 
I asked Phillipa if this stigma was something the committee addressed, as it certainly is a line-up of variety. “Classical music is still there but we’ve tried to broaden the appeal. I think we’ve just moved in that direction as a result of an awareness that the requirement is changing and we’re trying to be more inclusive.”

 
So, what else is up for grabs this year? Children’s author Clive Mantle will be entertaining youngsters with illustrated readings from his time-travelling, Himalayan adventure and talking about his writing and his own travels in Nepal (1st June. Devizes Town Hall 2:30pm.) Although familiar as an actor to audiences of Holby, Vicar of Dibley and Game of Thrones, Clive Mantle is also now a successful children’s author: his first book “The Treasure at the Top of the World” was short-listed for the People’s Book Award and a second book in the series is due out in June. This is suitable for eight-year-olds and above.

Gareth-Jones

Also, for young-uns, Blue Peter Award winning author and performer, Gareth P Jones presents Aliens in Devizes! (8th June. Town Hall) Pet Defenders, a secret organisation of dogs, cats, rabbits and rodents dedicated to keeping the Earth safe from alien invasion. Suitable ages from six to nine, but sounds like fun to me!

 
The best jazz violinist in the country, Christian Garrick and John Etheridge, one of the most stunningly versatile guitarists, presents Strings on Fire (3rd June. The Exchange.) Meanwhile, two siblings that make up the exceptional violin and viola duo, String Sisters, Angharad and Lowri Thomas String Sisters are at St. Andrews Church on the 5th June. Multiple award-winning musicians, who’ve played with Alfie Boe, Michael Ball, Paloma Faith, Marc Almond, Boy George and Robbie Williams.

String-Sisters.jpg

2nd June at The Bear Hotel Ballroom, there’s a quirky, funny and poignant award-winning solo show about Nick Drake; a celebration of music, photography, life, coincidences and the legacy of one of the most influential singers/song-writers of the last fifty years.

 
Competitive improv as you’ve never seen it, The Shakespeare Smackdown (4th June. The Exchange,) is from the creators of Olivier Award-winning “Showstopper! The Improvised Musical.” Britain’s favourite celebrity organic gardener and Gardeners’ Question Time star panellist, Bob Flowerdew has An Audience with on the 5th June at Devizes Town Hall.

elspeth_beard1.jpg

From Atila singing the Nat King Cole Story (6th June. Town Hall) to the dark comic and eclectic music of Moscow Drug Club (7th June Corn Exchange) and from An Audience with grand dame of English literature, Fay Weldon (8th June. Bear Hotel) to Elspeth Beard, the first British woman to motorcycle around the world (8th June. Bear Hotel) no one can deny the quality and variety is extraordinary this year. Talks on Sci-Fi influences on evolutionary linguistics, a homage of renditions of Eric and Ernie, author Clare Mulley’s on her third book, “The Women Who Flew for Hitler”, open mic poetry session with Josephine Corcoran, in fact there’s too much here to list in one article, my wordcount exploding and I fear you’ll be bedazzled by it all.

EricErn3.jpg

So why don’t we regroup tomorrow, when we’ll highlight, in particular, the free fringe events? Phillipa, in charge of the fringe events, notes surprisingly, that although “the fringe events are subsided, for some reason they don’t seem to attract that many people, compared with ticketed recent events such as Rick Wakeman at £45, which sold out.” I think this is down to the aforementioned stigma, and here at Devizine I’m dedicated to prove it wrong. So, same time tomorrow then?

 

Adverts & All That!

 

stove1little genevapostfamilydiscoSpring concert POSTER 2019. C.inddjamieowlknati6thmade in dageborntorumScooterRallyposterNovvinylrealm

Stone Mountain Sinners at Dead Kool’s Final Night at The Cons Club

Returning favourites, The Stone Mountain Sinners pulled a sizable crowd to Dead Kool Promotion’s final hoedown at the Devizes Conservative Club last night. The accomplished Worcestershire country-rock six-piece belted out some dazzling country riffs fused with energetic rock n roll/blues nods. It was just how I suspected it’d be as drafted in our preview piece, that’s why I took the opportunity to drop in.

 
While stereotypically the genre admittedly not to my usual tastes my eclectic toe was tapping, here’s perfect example of the cross-over Dean pushes for, to appease both regular country aficionados and newcomers. For a sprinkling were Stetson-wearing adherents, but the bulk in attendance were everyday local music lovers.

IMG_2713

Covered in our preview was the harmonies of the two vocalists, Neil and Sarah, and they certainly took full advantage of this, as fronting a professional and tightly accomplished band, they shared the session uniquely and wonderfully, though I note while Neil took lead on the more country angled songs, Sarah had that poignant strength to twist some seriously grinding rock elements. After the first instance of this I felt the need to capture it on one my wobbly videos, but the following song lowered the tempo again to country, nevertheless, here it is!

 

Ah, king of the wonky sound-crackling video, they never do justice to the acts, you have to use a heap of imagination to note it was far better than it may sound here!

It sure was one grand performance, producing a night celebrating all that is good about the club, it’s balance between archetypical country and the diversity of its backlash.

 

Bringing in Devizes best singer/songwriter Jamie R Hawkins as support being a fine example. Jamie gave us his masterworks, expressed a fondness of country and mollified the audience with his own more-country inspired songs, such as Man of Simple Means.

 
Chatting outside he told me of his roots as a family band playing the country music circuit and we discussed his fondness of song-writing. I noted the narrative in his writing, a complete story, often with a twist is something all-together country; a skill Jamie rightly prides himself on.

IMG_2709

 

 

The night was prodigious, yet the arrangement of seating in the venue acts somewhat as a barricade between audience and artist, I feel, if left open for dancing it takes a while to encourage this. I note while the other clubs arrange this differently, Long Street Blues pushes seats up to the stage for optimal intensity, whereas The Scooter Club do the opposite, leaving a wider dancefloor, as the nature of its genre is more danceable. For this sole reason I welcome the venue change for the Country Club to the Cavalier on Eastleigh Rd for future events. It’ll be more imitate, engaging the audience more.

 
I look forward to seeing how this development progresses, for the Hannah Johnson & The Broken Hearts gig it’ll be perfect, for the Family Club tribute nights, a pub location rather than function hall will give it the community feel and closeness it craves. And if the club pulls in bands as good as The Stone Mountain Sinners, well, boom!

 

Adverts & All That!

Spring concert POSTER 2019. C.inddlittle genevapostjamieowldecontonicposterknati6thmade in dageborntorumvinylrealmonceupontimestove1

 

Decatonics to take Devizes to Skaville!

Designing the posters for the Devizes Scooter Club came to the peak of absurdity with this one for the latest event on the 30th March, and I feel I may need tone down the experimentation a tad. Still, I think it stands out from the run-the-mill event poster; in the words of Mike the Cool Person, “I never stand on convention, it never stood on me.”

decontonicposter

But I cannot deny, with a bombardment of highly anticipated local gigs this coming month, I’m looking forward to this one perhaps, the most. We’ve seen a few Northern Soul and Motown nights of recent from the Scooter Club, and while my eclectic taste appreciates these along with the plethora of other gigs lined up on my calendar, you still can’t, in my opinion, beat a bit of ska.

This will reflect well against the forthcoming Scooter Rally, as while a weekend-long event will provide scope for the club to parade all relevant genres, there’s a truckload of ska to be heard. Orange Street headlining will be one to watch, while Swindon’s The Tribe mesh ska with hip hop beats, and other local outfit The Erin Bardwell Collective will simmer in some rock steady. Essex’s finest, The Start are not averse to playing ska, and I’m sure, given the nature of the event that the Day Breakers will blast a two-tone classic or three. Of course, Bad Manners tribute Special Brew take as red.

Confident in the statement international third-gen ska is regenerating the old Two-Tone scene here in England, is evident in the success of groups like the Dualers. Call it cliché, say yeah, diehard skins don’t know when to give it up, but there’s something in that joyous offbeat which makes you want to jump and skank.

dec4

So put your braces together, your boots on your feet, and allow me to introduce this prodigious booking, Dorset’s eight-piece ska band, The Decatonics. It promises to be a blinding night at the Devizes Conservative Club. The band, formed in 2012 have indeed supported the aforementioned Dualers, along with The Skatelites, The Neville Staple Band and Bad Manners.

An established 8-piece female-fronted ska band, The Decatonics are constructed of bassist Rowan, two Steves, one on keys and the other on drums, an energetic backline and powerful horn section of Mike on tenor sax, Harry on trumpet and alto sax, and Ian on trombone. They’re fronted by two adept vocalists who compliment one another; Shaun, also on lead guitar and Sally, who I’ve been chatting with. I started by asking her how long they’d been together and if the members were the same original line-up.

“The bass and I, and the lead brass, are original, with our drummer being with us for five years,” she explained, “but as with any large band, changes are inevitable along the way.”

dec2

“Is it all covers, or have you any original songs recorded?” I asked Sally.

“We do just cover songs,” she sustained, “but try and give our own little flair, and being female-fronted we get to play a more diverse set than your standard ska covers band.” No issue there, in retrospective glory, cover songs make the night at the Scooter Club. Not forgoing, Sally mentioned that since 2017, The Decatonics have been part of a Specialised Project, recording tracks for a CD. I saw my opening, boasted of my newfound show on Boot Boy Radio and blagged two tunes to play on the show next week!

The first song a Trojan hit in the UK, Bob & Marica’s up-tempo Pied Piper, proves their ability to sprinkle a joyous contemporary ska riff to a boss reggae classic, but the second hoists up that skill, with a concentrated ska adaption of the Jam’s Standards.

dec3

The Decatonics draw influences from both original Jamaican ska, bluebeat, and its new-wave Two-Tone, but also from successors rock steady and reggae. They even accommodate soul in the melting pot, bringing a vibrant live show which has built up a great reputation with the entire mod/scooter scene rather than just ska aficionados. Do not expect third generation punk experimentation, but a suitable English ska sound popularised by Madness and The Beat.

With a strong following through regular pub and club gigs, and festivals such as the Big One Weekender Festival, Dorset Volksfest, The Dorset Steam Fair and Teddy Rocks under their belt, I’m certain they’ll transport their astounding party atmosphere to our already lively Devizes Scooter Club nights.

dec1

Tickets are a tenner, by messaging the Devizes Scooter Club Facebook page, from Vinyl Realm, Jefferson’s Café, or from the Devizes Cons Club direct. As usual there will be a raffle, and I believe it’s me warming up the crowd on the wheels of steel, like a musical fluffer; but don’t let that put you off! The club ascertain everyone is welcome, not just members. Think of this as an opportunity to taste what you might bear witness to at the forthcoming Rally in July, oh and to have a good knees-up too!

 

Adverts & All That!

stonemountainSpring concert POSTER 2019. C.inddlittle genevapostjamieowlfamilydiscoknati6thbuddyhollylivesmade in dageborntorumonceupontimeScooterRallyposterNovvinylrealmstove1bootboy

You’ll be Broken-Hearted to miss Hannah Johnson

Howdy; yeah, it’s me, riding back to the crossroads on a horse with no name to convince you, once again, that your preconceived ideals about country music are not made of Spanish leather. Hannah Johnson & The Broken Hearts stroll into town on the 23rd March to cast this caboodle out to the desert. Not that we have a desert, but in a way, that’s my point.

deadkool

It’s easy to tire of the cliché of the modern country scene and arrive at the conclusion it’s not for you. Agreed, if you screech much of the music coming out of Nashville today denotes watered down country-pop, or stylistically pretentious Americana; same old chanted choruses and stomping drums, country music aficionado Dean Czerwionka, of Wiltshire’s Country Music Scene, Dead Kool Promotions aims to set the record straight.

Keen to promote and bring us all that is great about the scene, rather than the standardised churns of the industry machine, Dean hosts Hannah Johnson & The Broken Hearts at the Cavalier, Devizes on the 23rd March, with one of Devizine’s favourites, the Celtic-based acoustic duo, Sound Affects as support.

 

Surprisingly, it’s our homegrown artists reacting against this notion, and Hannah Johnson is of no exception, she’s from Birmingham. This award-winning (UK Country Artist of the Year 2018 – UK Country Music Awards and Most Successful British & Irish Single 2017, Hotdisc Country Music Awards) Brummie girl began her artistic career working in theatre and television as a child, participating in an unabridged version of a Midsummer Night’s Dream, playing Puck, aged 11, part of a Central Television actors’ workshop, and acting in national children’s TV shows. But ‘tired of being someone else on stage’ and hailing from a musical home, she began singing, and initially studied the clarinet, but switched to guitar in her teens; realising she couldn’t use the clarinet to back up her vocals.

She soon found a home with the country music genre, through its “humility, simplicity and ability face emotionally complex topics,” not forgoing fifteen years touring extensively in the UK, Europe and the USA as lead in her family band, The Toy Hearts. Hannah’s composition The Captain remains the biggest hit for her family band, the song a testament to both her song-writing ability, and her fierce independence.

hannah1.jpeg

An Alumni of the prestigious IBMA Leadership Bluegrass program, Hannah returns to the UK after a whirlwind tour of Austin, Texas, with shows in London, York, Doncaster, of course her beloved Birmingham, and Devizes. Her debut album, Shaken rinses of country and honky-tonk of yore, with characteristic twangy telecaster riffs and a singing style to make Tammy Wynette blush. With a slight smoky element of Patsy Cline to her voice, the standout tracks are her own compositions, receiving warm reviews.

An event then to warm country fans, and perhaps, ideal to introduce newcomers; you may be the broken hearted of her band title if you miss this one. This event is FREE, waddies, rustlers and cowgirls.

 

Adverts & All That!

 

vinylrealmfamilydiscolittle genevapostSpring concert POSTER 2019. C.indddecontonicposterbuddyhollylivesknati6thmade in dageborntorumonceupontimeScooterRallyposterNovstove1

Hot Blues on a Cold Night

Kyla Brox Band – Saturday 2nd March @ Long Street Blues Club, Devizes

Andy Fawthrop

 

Back up the road to the Con Club for Long Street Blues Club’s latest presentation – The Kyla Brox Band. And it was definitely worth the hike.

k4

Yet again Ian Hopkins had managed to get one of Britain’s top blues & soul bands in front of a Devizes audience on a Saturday night, and the crowd lapped it up. Winner of the 2018 UK Blues Challenge, Kyla’s reputation preceded her. And we were not to be disappointed -an outstanding performer with an incredible pair of lungs on her, knocking out some soulful, smoky and gritty lyrics. Her voice covered all the bases, from the cool, sexy drawl, belting through the mid-range rock chick style, to the high-end screaming wail of soulful pain. And the band behind her were as tight as a tourniquet.

k3

The three-piece featured the fluent guitar work of Paul Farr, some inspired bass playing by Danny Blomeley and tight drumming by Mark Warburton. Farr, in particular, impressed with some of his inspired solos, drawing wild applause from the crowd.

The absolute highlight for me was the final number in the first set – one of the best versions I’ve ever heard of the classic Etta James song “I’d Rather Go Blind”, with Kyla pulling out all the stops to press every emotional button. To say that she completely nailed this number would be something of an under-statement – worth the entrance money on its own. The material throughout varied from up-tempo, high-energy blues through to low and slow, crooning soul, and it was great to hear these different textures through the two sets. The band’s ability to turn up the burners, and then cool right down, number after number really demonstrated their versatility. k2

The only time I felt that the band put a slight foot wrong was the choice of Leonard Cohen’s “Hallelujah” for the first encore – can this song that has been one of the most-ever covered pieces still having anything else left to give? – the answer, sadly, was a No from me. Fortunately there was a great up-tempo number to finish the evening off, and the minor damage was thus quickly repaired.

All-in-all another beltingly good gig, and a great night out.

Next gigs coming up @ Long Street Blues:

• Saturday 6th April Billy Walton Band – electric blues & Memphis soul
• Saturday 4th May Shemekia Copeland – passionate Americana roots & soul
• Friday 10th May Tom C Walker – young virtuoso guitarist
• Saturday 25th May Kossoff…The Band Plays On – fine, high-calibre tribute band

 

Adverts & All That!

vinylrealmstonemountainlittle genevapostSpring concert POSTER 2019. C.indddecontonicpostermade in dageborntorumstove1ScooterRallyposterNovdevizes familyclubbanddirctsquaare

Snakes in a Museum

Yes, it’s a cross between Night at the Museum and Snakes on a Plane, except neither Samuel L Jackson or Ben Stiller will be there, neither any real snakes, which may be no bad thing. This is Devizes, home to the wonderful Wiltshire Museum, where two snakes have slithered up the outside of the Museum building! The snakes were made by Wiltshire Young Carers at a workshop held in the Museum during February half-term.

mus.jpg
This Secret lives of Snakes, family-friendly exhibition opened yesterday. No real snakes, but the exhibit contains lots of interesting facts and details about these fascinating creatures. There’s lots of wonderful photographs, skeletons and taxidermy to highlight the world of these secretive creatures.

snake_514114-edit-958x848

Interactives for children include a snake trail around the Museum. Also, relating to the exhibit, the Saturday morning club for 7-14-year olds, Young WANHS have, “Sssnakes …” – snake-themed craft activities for on 9 March, from 10.15am – 12.15pm. There’s no annual fee, but pre-booking is essential to help the Museum plan the sessions. Each session costs £5 per child.

snakes1x5332

Then, on Tuesday 16th April, there’s a Jonathan’s Jungle Roadshow for younger children, suitable for age 4 and over. Children will have the amazing opportunity to find out about, handle and touch a diverse selection of fantastic live animals, including snakes. There are two sessions, 10.15am or 11.30am, each one lasts an hour and is again, £5. Accompanying adults free. Booking is essential as it’s only 15 children per session.

snakes2x533h3The exhibition runs until 28th April, normal Museum admission charges apply, but children and WANHS members are free. The Museum is now open Monday to Saturday – 10am to 5pm and Sundays – noon to 4pm. Bank Holidays may vary, check their website.

 
Yes, there’s stuff for the grownups too, such as lectures; Identity and Ideology during the Beaker period, by Chris Carey, University of Brighton on 30th March, is the only one not sold out. But none of them have got snakes in them! Where’s the fun in that?!

 

Adverts & All That!

 

stove1Spring concert POSTER 2019. C.inddlittle genevapoststonemountaindecontonicposterbuddyhollylivesmade in dageborntorumvinylrealm

Wiltshire Council Welcome Proposed Road Signs

Since a Wiltshire Council highway engineer advised Devizes Town Council that a sign at the High Street junction with Long Street is not big enough or in the right position last week, the highway engineer has been around our area suggesting other improvements which must be enforced for safety purposes.

 
Devizes Town Councillors were warned people might not spot the present ‘No Entry’ sign, and that it needs to be 600 CMs wide, wider than the road itself. “Maybe even larger, the bigger the better,” said a Wiltshire Council spokesperson, the one who really has the mentality to grasp simple English. “If it means we have to knock down a few historic buildings to make room, then we will.”

 
“We’d really favour,” the spokesman continued, “that the sign is lit with flashing neon letter-lights and overhead floodlights, twenty-four hours a day. Perhaps, it could also repetitively play a Bonnie Tyler song, or even the soundtrack to Rocky 4, to raise awareness of it too.”

 
“Devizes Town Council is clearly not accounting for the prerogative of speeding businessmen in BMWs belting through Devizes without a finger of fudge to road safety. They may have important calls to make on their phones, be preoccupied trying to locate a Starbucks, or generally too busy eyeing up totty to notice the clearly one-way street has standard no entry signs.”

 
The Wiltshire Council spokesperson, who cannot be named because their nametag fell out of their work jumper, because their mum didn’t iron it on well enough, stated, “those who think there’s no accounting for stupidity are wrong. One blast of ‘Eye of the Tiger’ or ‘Holding out for a Hero’ will alert the most insensitive arsehole; it’s certainly one of my favourite songs.”

 
With this apparent compete lack of competence of town councils to identify these issues, the Wiltshire Council highway engineer has proposed a new selection of signs be erected in obvious danger areas, using visual aids rather than a report, as he can only write in emoji.

 
Devizine has received these exclusive graphic representations for residents to swoon over in delight. I asked the Wiltshire Council spokesperson if he thought they were slightly aesthetically intrusive. “No,” he replied, “I think athletes will love them too.”

stonehengesigndevizes roadwhitehorsesignsilburysiignwelcometomarllongbarrowricksteinmarketplacecounty hall

Adverts & All That!

little genevapoststoriesSpring concert POSTER 2019. C.indddecontonicposterAsYouLikeItmade in dageborntorumsadleback-blues-festival-logo-2019vinylrealmstove1

A Funky Sensation in Devizes

Devizes set to party like it’s 1999; zipping up my boots with Funky Sensation.

 

Normally, if there’s a funky sensation in Devizes it means it’s been foggy post-harvest and the aroma of manure has filtered into town. In a similar light, I confess, I’ve been critical in the past about our only nightclub, events hosted tend to mimic what’s on elsewhere, and I really feel tribute acts have a home in hire venues and pubs, but not necessarily in a night club. It’s an age thing perhaps, usual nights too commercialised for me, recalling the clubbing scene of the eighties, how it assisted in spawning a decade of raves. To me, a night in a nightclub should be concentrated on DJ culture, be dissident dance music, and most importantly, should be banging, mate.

 
Here then is something that lacks in Devizes, flourishing with original music a trend I adore, though surely there’s a place for dance music too? A glitch set to change; with the potential to be a grand night at the Funky Sensation launch in the Exchange on the 5th April, I caught up with the hosting DJ, George Penny, to find out more about this Funky Sensation event doing the rounds on Facebook.

funky sensation 3

“Basically, I used to DJ about twenty years ago, free parties, private parties and a club residency,” explains George, who goes by the DJ tag George G-Force. “But then work, life, mortgage, wife, child came along.” It’s not so uncommon, for many the desire to create, artistically or musically though will return to bite them, and George started mixing again about four years ago. “I’ve been trying to get back out on the circuit, but it’s a lot harder now, a lot more competition.”

 
He’s been DJing in Frome and Bristol, with appearances for the ‘House of Disco’ collective and Input2 Promotions, but explains, “I always wanted to try and put on my own party a bit closer to home (Melksham) but had really been struggling trying to find a venue. I only heard about The Exchange three weeks ago and I think it’s perfect in terms of location; hoping to pull people from Melksham, Trowbridge, Calne and Chippenham.”

 
So, busting out of retirement, and ready to bring the heat with his unique blend of nu-disco and classic-vocal-funky house vibes, G-Force is set to take Devizes back to an era when clubbing meant clubbing. “We want to bring the fun back, with good old uplifting, hands in the air, sing-a-long music. That could be a classic disco track/re-edit, house anthem or a modern-day club banger!”

funky sensation2.jpg

He brings along special guest DJ, Nina LoVe and DJ Stach. Akin to George, Nina took a decade away from the scene to concentrate on family and studies. But with a childhood filled with classical music and musical theatre, and discovering dance music and raving in the nineties, she couldn’t hold the bug in much longer than 2012, as with the discovery of Disclosure and Gorgon City, that led to a new energy for House music, vinyl junkie Nina started learning to mix.

 
Bath-based Stach has been playing to enthralled crowds since 1990, kicking off his career within the techno scene on the Isle of Wight. Since those halcyon days, DJ Stach has played many genres and has a wide repertoire; pleasing audiences with epic sets featuring nu-disco, classic and tech-house.

 
He can be found on the set lists of some of the UK’s best boutique festivals and coolest club nights, as well as elite private parties. Previous sets include: Shindig Weekender, Grinagog Festival, Love Summer Festival, The Backroom, and The Nest in Bath.

 
I gulp when my chat with George raises Shindig, as organiser Slim Goodgroove and I go back to art college days, the dawning of the breakbeat rave explosion and through to the fluffy house days of his Stardust Collective. Time to get all fuzzy and waffle off a parable or three, Uncle Albert style. Think I’m boring George now, I’ve a tendency to do that, but in hindsight, I really think a decent dance night is missing from the variety of things to do in Devizes, and welcome this prospect.

 
“I’ve never done anything like this before,” George tells, “but thought I’d give it a shot. Obviously, if we get enough people the aim would be to do it, maybe, three times a year.”
So, from old raver to young house music aficionado, take note; it may be time to dust off your old white gloves and relight the glowsticks. I never thought I’d see the day! Tickets for this launch party, at a fiver, are available from today.

 

Adverts & All That!

vinylrealmmelkcarbootwellyfeststonemountainlittle genevapostdecontonicposterbuddyhollylivesmade in dageborntorumkennet-avon-canal3-1280x640sadleback-blues-festival-logo-2019stove1

Shakespeare Back at the Wharf Theatre

Aye, heareth this, mine own cater-cousins, Shakey is backeth at the Wharf Theatre in Marcheth; timeth to beest did enlighten and amus’d.

 
Liz Sharman, who directed the incredibly successful, “A Funny Thing Happened on The Way to The Forum” last year, is taking the helm again for William Shakespeare’s “As You Like It;” it promises to be a strong show.

 
Showing from Monday 11th to Saturday 16th March at 7.30pm, this 1599 pastoral comedy has remained an audience favourite for over four hundred years.

 
Duke Senior has been usurped by his younger brother Duke Frederick and is now exiled from the controlling confines of court. His daughter Rosalind and her cousin Celia have also run away and arrive in the forest with Rosalind now dressed as a young man in order to avoid detection. Others taking refuge amongst the country folk of the Forest of Arden include Rosalind’s admirer Orlando, the court fool, Touchstone and melancholy traveller, Jaques, who gives many of Shakespeare’s most famous speeches including “All the world’s a stage”, “Too much of a good thing” and “A fool! A fool! I met a fool in the forest!”

 
As with all good comedies much confusion ensues amongst the wooing as society’s rules are overthrown. As You Like It remains an exuberant theatrical journey featuring several songs, a wrestling match, a joyful quadruple wedding and no funeral!

wharf

Tickets (£12/under 16s £10) can be purchased from Ticketsource at: https://www.ticketsource.co.uk/the-wharf-theatre/events or at the Devizes Community Hub and Library on Sheep Street, Monday to Friday, 9am-5pm or by ringing 03336 663 366.

 
To find out what else is on at the Wharf pick up a new Spring/Summer brochure which is now available from the Community Hub and Library and many other outlets around Devizes.

 
For further information contact Karen Ellis: http://www.publicity@wharftheatre.co.uk

 

Adverts & All That!

stove1aadamsruzzmikeowlterryhen2019txtlittle genevapoststonemountainbuddyhollylivesmade in dagevinylrealm

Stone Mountain, Devizes

Previewing the appearance of the Stone Mountain Sinners at The Devizes Ameripolitan Club on March 9th today; Americana meets homegrown talent.

deadkool

It’s been a couple of years since I first met country music aficionado Dean Czerwionka at the Conservative Club during one of his events. Back then he called it Devizes Country Music Club, today it’s the Ameripolitan Club. The name change, I deduce, is a bid to amend preconceived ideas of what country music is about, similarly was the angle of the article.

 
If you go running off with ideas of line-dancing and achy-breaky hearts you’re only skimming a stereotypical surface, for Dean is keen to promote bands which break this pigeonhole. Leaning at the bar in his Stetson, I recall the tête-à-tête moving onto the notion both media and other country clubs thrive on the arrival of US touring bands, when a homegrown scene is perhaps equally as poignant.

stone3

On following this advice, I confess I’ve cringed at some, and tumbleweeds passed by, where there’s cliché subject matter of Americana; homages to the gold rush, box-cars and jumping railroads yodel “pack it in, you’re from Slough!” But song’s subject matter of one band Dean tipped me to, The Stone Mountain Sinners, are adequately general and could be applied to either home or the Harpeth River. While their melodies nod to Nashville, there’s hints of English blues harmonies and strokes of a young Rod Stewart.

 
Well-worn territory perhaps, where UK country music caresses it’s rock n roll offspring, but Worcester’s Stone Mountain Sinners do it with panache and professionalism. It’s toe-tapping goodness with familiarity aplenty to woe those with only a passing interest in the genre, while still appeasing devotees. Subsequently, under a trail of blazing reviews, their debut album, Tones of Home is currently teetering at #5 on the iTunes Country Chart, since it’s October release.

 
Working as a touring guitar tech, it was in the Californian desert, beside the 29 Palms Highway on a US tour, where Neil Ivison had his epiphany to return to the UK to labour on new music, inspired by the regular jaunts to the southern States. So even if there’s a heap of Americana in the sound, it’s justified.

stone1

 
And what’s in a name I asked Neil, being Stone Mountain is a Georgia city and gateway to Stone Mountain Park, is there a connection? Evidence that the US influence is not exclusively the theme in his answer, “no connection to Georgia, we basically wrote a load of words down and then pieced them together until we came up with something that sounded good!”

 
After the conclusion of his first band, Neil found similar ground to Sarah Warren’s social media posts of her culminating group. One email was all it took before they were collaborating, bringing in Sarah’s musical cohort, and Nick Lyndon.

 
“What was immediately striking was that our voices complimented each other so well,” Sarah explains, “we both have strong vocals but we each have our own tonality, so it’s not like we are battling each other for space in a song.” Indeed, it works, try this video if you don’t trust my word on it!

They headhunted pianist Roger Roberts, bassist Adam Hood and drummer Duke Delight and formed Stone Mountain Sinners, attracting Robert Plant who pitched up to check them out after only their second gig. Straight into the legendary Rockfield Studios in Monmouth they marched, a year ago, to record the debut album with The Waterboys, Pogues and Hawkwind producer, Paul Cobbold.

stone4
They’ll appear at the Devizes Conservative Club on Saturday March 9th with trusty Devizes favourite Jamie R Hawkins as support. Tickets online here, at £7. Not their first appearance in town, but they’re given the red-carpet treatment with an exclusive sample performance at Vinyl Realm that afternoon, after a morning stint with Sue Davies on BBC Wiltshire from 11am.

 

Adverts & All That!

stonemountainruzzmikeowlterryhen2019txtfitpklittle genevapostvinylrealmmade in dageborntorumbanddirctsquaarestove1

A Get Together with Arts Together

“What we have learned is that simply offering support or information is sometimes not enough,” states Age UK, “older people who are in the worst place often feel there is no hope, leading to a vicious circle of low self-esteem, lack of motivation and reluctance sometimes to ask for, or accept help.”

 
What sounds bad on paper, is often not as the eye perceives. While undoubtedly this is fact, I’m visiting Kestrel Court in Bowerhill, sheltered accommodation for elderly. I bear witness to a lively group, not just engaged in an art class, but merrily lapping up every minute of it. There’re cakes in abundance, tea, and some Mozart as background music. At one-point Gerald gets up to strum a guitar, and once the class is all but ended, the artist Clifton Powell slipped on some reggae; despite hard-of-hearing and cataract, Gladys, from Paraguay, is up dancing.

 
This is the doing of a charity group called Arts Together.

artsto7

“I’ve never been a person who joins groups,” Sue tells me as we sit together admiring her still life watercolour, “always been on the edge looking in. I really feel part of this group; that’s so unusual.” Arts Together is perhaps a slightly misleading name for this local charity, as while indeed it provides members with tutorials and equipment to engage in a wide variety of art projects, it also acts as wellbeing, and an invaluable social group.

 
I asked Sue about the community side to it, did she balance it’s worth with the actual art as half-and-half. She agreed it was equally vital, describing her battle with depression. “But this kind of thing really addresses it. There’s so many of the things they say you should do, going to your doctor, behaviour training and what have you, which has never helped me. And then you get something like this, which has been a real help. If this was on prescription, I’d be asking my doctor for it!”

 

artsto5

Sue reveals a creative nature, she’s written poems and performed them. Other members of the group, such as Carol, who proudly holds up her painting to show me, has no previous artistic calling. There’s a varied degree of skill, but Clifton commends and encourages all, a reason they all sing his praises. He was joined last minute by Rachel Heard, a Wiltshire artist, known for her “explorations of natural forms,” painting.

 
Arts Together have thirteen accomplished artists, and many group volunteers. In the last year they’ve delivered 180 art sessions, over their six locations across the county. Arts Together meet, in Bradford, Trowbridge, Devizes, Pewsey, Marlborough and here, in Melksham. Projects are as wide as wire and clay sculptures, mosaics and textiles. Sue particularly warmed to the puppet making workshop. I’ve invaded the final meet of this still life project, frames are scattered over the table, once completed a windowsill becomes a makeshift gallery, presenting their work.

 


Arts Together works to support older people who have become physically and socially isolated. I did ponder if they catered for dementia patients and such like, but was informed care homes and hospices organise their own activities, while the elderly in sheltered accommodation are often left out. “There’s nothing like this around here,” I’m told. So, while I didn’t class this as “art therapy” in similar light, it’s indubitably therapeutic, it stimulates and actively encourages the participants to try new things, to be creative and social. In a word, it’s wonderful.

 

artsto6

But I’m moved by Arts Together manager, Karolyne’s announcement, “We are on the brink of closure and desperately help.” While this is not the first time the charity has been under financial pressure, they assure me it’s the worst. “Any statutory funding from public money disappeared years ago and it has been our supporters and some enlightened Trusts that have helped us survive.” I find myself shrugging; sad sign of the times.

 
This isn’t some large charity with a whole department dedicated to fundraising, managers balancing campiagns with sessions. It’s lunchtime as I get my coat, I’m invited to stay but cannot. Agreeably I attended for some media exposure, but so welcomed I left with sensation of making real friends. I imagine life for these newfound friends without Arts Together, and shudder.

 
Without Arts Together members return to a solitary, empty week, consequently effecting their health and wellbeing. Wellbeing was a word passed around a lot today, the charity take pride in their achievement, help them maintain it.

 

artsto4
There’s a coffee morning at Rick Stein’s on the High Street in Marlborough, on 1st March. Admission by £5 minimum donation, includes coffee tea and cake.

 

I’d like to thank the members I met today, it truly was fun and an inspiration to meet you, and the team behind it. I was enlightened, and think Devizine should stage a fundraising event too, as soon as possible. Anyone interested in helping with me on that please get in touch.

 
Until then, you can donate on the website; please, please, if you can, do. If you’re an artist consider volunteering some time. Any donation from you will help around 80 very frail older people to rediscover their zest for life. Arts Together enables them to rebuild their confidence, self-esteem and resilience and remain living independently in the community for as long as possible.

 

Adverts & All That!

stove1wintreralesaadamscharitylionsfamilyclubkiddiscofitpkruzzterryhen2019txtmikeowllittle genevapostbuddyhollylivesmade in dageborntorumvinylrealm

Half Term Fill: Local Things To Do For Kids

Big gulp of wine Mums, it’s half term next week. Okay, that’s quite enough, don’t panic. From daffodil picking, cooking and first aid, to football, driving tanks and having a go at being a DJ, here’s some things to keep little soldiers and princesses of all ages at bay, and smiling!

 
Sure thing is a movie; “How to Train Your Dragon: The Hidden World,” is at the Palace Cinema, from today until Thursday 21st. “The Lego Movie 2” is a must, from Friday 15th also until Thursday 21st.

 

picturedromelogo

From Thursday 14th through to Friday 22nd there’s a funfair at The County Ground in Swindon, from 2pm. Scream if you want me to go faster, or you’re running low on wine.

 
There will be the usual free swimming at the Leisure Centres, but check ahead, as some timetables have changed.

freeswimiimng

You could take them for a trip down the Kennet & Avon, The Admiral is free on Saturday 16th and Sunday 17th, find it at the Caen Hill Café, below the bridge at lock 44, at 11am. There will be trial sheets to explore the Jubilee Woods, and, back on board there will be a history of the canal and its restoration.

halftermadmireal

Starting Saturday 16th, you can pick your own daffodils at Woodborough’s Whitehall Garden Centre, available daily until 31st March. £4.99 per bag. Both centres, at Woodbrough and Lacock, have a Gardening Nature Trail until Thursday 21st. Claim a lollipop at customer services for every completed entry.

familyclubkiddisco

Saturday (16th) The Devizes Family Club have at Children’s Disco at the Conservative Club. 6:30-8pm, all are welcome but only above 9 years should be left. There’s an adult creche for you, with bar! £3 on the door, lucky dip 50p, tbc face painting and optional princess and superhero fancy dress. Proceeds are going to Rowde Academy.

 
Starting Sunday and running through the week, The Wyvern Theatre in Swindon has a roadshow at The Brunel Centre, inviting children to join in at The Crossing, to make dinosaurs or dragons to celebrate the arrival of Dinosaur World Live and Julia Donaldson’s Zog in April.

 
In Melksham there’s activities all week long at Young Melksham’s The Canberra Club. These clubs are for all young people in Year 5 and above (aged 8 to 16) and will run from 2pm till 5pm Monday to Friday, with entry costing £2.50 per session or a week-long pass for just £10. There will be a plenty of activities on offer including pool, table tennis, table football, arts and crafts, karaoke, cooking and baking, games and sports and much more. There are also computers and consoles available for use and a chill out room where you can watch tv or a film together.

young

The Canberra Centre is amazing building with lots of space to run around and have fun and play games with your friends. There is also an outside courtyard for football, basketball and just burning off some energy! A variety of hot and cold food and snacks will be available to purchase as well as free squash.

 
How about teaching your nipper some line dancing on Monday? All ages and abilities welcome at The Town Hall, Devizes. Early Bird Session: 6.30-7.30pm £5 Beginners: 7-8pm £5. Improvers 7.30-9.30pm £6.

 
For footballers ages three to six, Devizes Town Youth has free coaching in their Little Kickers sessions from 9.30am to 11am on Monday, Wednesday and Friday at the Football Club. Kid receive a free t-shirt and football. To sign your child up contact Mr Sheridan on 07860232052 or Raymond King on 07917787903 or Jon Wozencraft on 07767851332

 
Tuesday and Wednesday with two sessions per day: 11.00am – 12.30pm & 1.30pm – 3.00pm, there’s Wildlife in Wiltshire at The Wiltshire Museum, Devizes. Art and Craft activities linked to their Natural History Exhibition. You can make animal masks, create animal models and pictures. These sessions are very popular, so booking is essential. It’s suitable for age 11 and under. Age 8 and under to be accompanied. £5 per child. Accompanying adults free.

 
Or maybe try your hand at being a DJ? Trowbridge’s Community Area Future has a Free Half Term DJ Workshop at Studley Green People’s Place on Tuesday 19th. DJ Nina LoVe will show you how to mix the Old Skool way, using vinyl records! There will be a few different types of music available – House, UK Garage or Drum and Bass. Come and check it out, book yourself some time on the decks or get on the microphone! For ages 13-18. Please feel free to drop in or call to book a place on 07765371051/tcaf@trowbridge.gov.uk

 
Have a go at a soldier-led assault course, plus Tank-themed fun family activities, at the REME Museum, Lyneham. Make your own tank with parachute and see if your engineering skills are up to scratch by dropping your tank “into battle” in one piece. On the artistic side, you can design and colour-in tanks. There’re model tanks which you can drive on a special course. Drop in from 11 am to 3 pm, any day from Tuesday until Friday. Special soldier run kid’s assault course will be running, plus fun tank-based kids trails, activities and craft in the museum. All children to be accompanied by an adult. All activities are included in the admission fee. Assault Course suitable for 5 – 12-year olds. The Museum is open from 10 am to 4.30 pm (last entry at 3.30 pm), some activities run from 11 am to 3 pm. Museum admission required to take part in activities. No pre-booking required for this activity, just turn up and enjoy.

 
Wednesday 20th is time to get fit in Hillworth Park, free event, in association with Boot Camp UK, it’s going to be all Sprint, Slide, Shake, Scamper, Scurry, Swing and Stomp!

fitpk

For arts and crafts, Fired Thoughts at the Old Potato Yard, Devizes, has Half Term Lino Workshops, from Wednesday to Friday. A two-hour workshop to design, cut and print using Lino and inks. All ages and abilities welcome. All materials included, but please book: Tel:01380 840666 email: info@firedthoughts.co.uk

 
At the Court Street Gallery in Trowbridge, there’s a Children’s Silk Sun Catchers Workshop on Wednesday at 10am. £15 per person including materials. To learn more and book, visit: www.nicoladaviscrafts.co.uk/workshops.html

 
How about some first aid training for your children? Louise Worsley, a qualified trainer is at Marlborough Rugby Club on Thursday, 21st, 09:30 – 15:30 with an essential First Aid Training for Children. Sessions are tailored to age groups and are full of practical to make them fun and memorable: 9:30-11am – Mini Life-Savers course for 5-8-year olds – £18 (£15 for a sibling.) 11:30am-1pm – Mini Life-Savers course for 8-12-year olds – £18 (£15 for a sibling) and 1:30-3:30pm – Teen-Aiders course for 12-16-year olds – £24 (£20 for a sibling)

 
Thursday is the opening night for MACS Theatre School’s “The Addams Family” at Devizes School. It runs until Sunday. Tickets at Devizes Books or online here. Doors open at 6:30pm for a curtain up at 7:30. There’s also a mini Macs matinee performance on Saturday at 2:30pm.

aadams

From Thursday until Saturday 23rd The Seend Village Pantomime presents “Snow White and the 7 Dwarfs.” It takes place at Seend Community Centre, it’s the Fawlty Players 40th Anniversary, and there’s three of the cast were in the first Snow White in 1981! Tickets at the Post Office and Community Centre.

 
At Bradford on Avon’s St Margaret’s Hall, two of Roald Dahl’s Revolting Rhymes will be performed by local theatre group, the multi award-winning Bradfordians Dramatic Society. A take on Dahl’s retelling of the classic fairy tales, Cinderella and Jack and the Beanstalk. Following their success with The Twits last year, the group will bring Dahl’s honest, often vicious wit and humour to the stage in this production. Show times: Thursday 21st February – 6.30PM, Friday 22nd February – 6.30PM, Saturday 23rd February – 11AM, Saturday 23rd February – 2.30PM, Sunday 24th February – 2.30PM. Head to the Bradfordian’s website to see the full cast and more information here: http://www.thebradfordians.com/

 
Learn some street dance with a taster class at Charlotte’s School of Dance, Bath Rd Business Centre, Devizes, at 7:30pm on Friday with Jacinta Childs. To book this £5 session text: 07903812364.

 
Aspiring chefs, Saturday 23rd is for you; Margaret Bryant hosts Middle Eastern at Vaughan’s Kitchen Cookery School, Devizes. Spicy (but not hot) Falafels; Hummus; Baklava. Designed to give your youngster a firm foundation that will provide them with the techniques and knowledge they need to grow into competent and confident cook, it is also lots of FUN and they will bring home the results of the session to share with the family.

 

That enough?! Still bored?

boredkid

Adverts & All That!

wintreralesruzzmikeowldecontonicposterbuddyhollyliveslittle genevapostmade in dageborntorumhauntedpostsadleback-blues-festival-logo-2019vinylrealmstove1skaingwestcountry

 

Talk in Code Announce Tour Dates

Beginning of January, I reviewed Swindon indie popsters, Talk in Code’s second album, Resolve; blinking catchy it is too. Now, they’ve announced they’re heading out on the road for a RESOLVE Tour.

“Talk in Code write throwaway pop songs you’ll want to listen to forever – how cool is that?”
-Dave Franklin, Swindon Advertiser

The February and March tour to promote Resolve will be stopping off at The Cellar Bar in Devizes on Friday 1st March.

talkincodefeat

The four-piece, who have supported names such as Catfish & The Bottlemen, Jesus Jones, Embrace, My Life Story and Toploader, are making waves in the indie music scene, having been featured on BBC Introducing, BBC 6 Music, Q Magazine Track of The Day, The Premium Blend Radio Show, and BBC Radio Wiltshire, with a session booked on Swindon 105.5FM later this month.

Talk in Code released Resolve in December 2018, with a homecoming show at Swindon’s Victoria. Now the band are talking their own unique blend of shimmering synth-led indie pop out on the road with a string of dates in the South, and a number of festival bookings throughout the summer all over the UK:

 
RESOLVE Tour Dates:

Thursday 28 February – JAGS Bar, Southsea, Portsmouth
Friday 1 March – Cellar Bar, Devizes
Saturday 2 March – Spice of Life, Soho, London
Thursday 14 March – Facebar, Reading
Friday 15 March – University of Gloucestershire, Cheltenham
Saturday 16 March – The Horn, St Albans
Saturday 30 March – Level III, Swindon (with The Britpop Boys)

RESOLVE album link:
https://soundcloud.com/talkincode/sets/talk-in-code-resolve/s-shw7Z

 

Adverts & That!

wintreralescharitylionsruzzaadamsmikeowlterryhen2019txtlittle genevapostdecontonicposterbuddyhollylivesmade in dagesadleback-blues-festival-logo-2019borntorumvinylrealmstove1skaingwestcountry

Storm in a Teacup; Concerns Over DOCA’s Carnival Change….

Images by Gail Foster

 

It’s easy to make a storm in a teacup in this hurtling era of social media: put one slightly erroneous newspaper article into a mug, brew some pretty strong local feelings on the issue, add a poll to a Facebook group as required; best served boiling.

 
Face it, it’s a lot harder to motivate yourself into actually helping out.

 
It’s clear the Front page in this week’s Gazette and Herald has been wrongly perceived as scaremongering, and failed to focus on the relevant points. Perhaps a slow news-week, but the intention to highlight the Devizes Outside Celebratory Arts (DOCA) need for funding has exploded into a social media frenzy over its date change, and employment of its key manager, Loz Samuels.

IMG_2483

If you felt like the article “was more concerned with one job loss than possibly losing an historic carnival,” consider without someone in Loz’s position, there would be no carnival at all. Besides, Loz expressed she only breezed over the fact her contract runs out with reporter, Joanne Moore, it was not supposed to be the key angle of the piece.

 
When a newspaper decides to run an article, it’s their prerogative which images they place, not the subject’s. Loz was as much surprised to see her own face on the front page as you, and is keen to point out, while funding for carnival, and the plethora of other events DOCA arrange is getting harder each year, it’s much the same as any year.

 
Loz herself works tirelessly with a team of volunteers to provide us with these fantastic, and mostly free events in Devizes, for what my tuppence is worth, she needs to be saluted and thanked, rather than dismally criticised for changes the committee as a whole have decided upon, and in their expert judgement, for good reasons.

f4

I ask Loz if she feels some people simply don’t like change, being the poll revealed a huge majority feel the date for the carnival should remain the same, in September, as opposed to being shifted forward to July. “More sceptical than not liking I think, until they see it, they’re afraid of the change.” She points out that Weymouth carnival has had to be stopped, expressing her concerns about the number of volunteers, and fund-raising needing to raise over half the cost, after the Town Council’s contributions. The Arts Funding Council require twenty-percent of costs secured before paying out, and in struggling times, local businesses and organisations find it hard to sponsor as much.

confetti.jpg

I ponder if popular opinion has not considered every tiny element which makes up DOCA events, every factor which needs to be taken into consideration. The Arts Funding doesn’t cover anything non-art, such as road closures and insurance, the availability and commitment volunteers are able to contribute thins, and yes, while Loz has concerns, and with less time now to arrange the carnival procession, she also confirmed she’s feeling far more optimistic than the newspaper article conveys. “In March,” she elucidates, “we should know.”

 

10g

Loz pointed towards the school’s eminent participation in the Christmas Lantern Parade and its workshops, to highlight the potential of the carnival’s date change. There is hope local schools will be able to organise themselves better, given the procession is within term-time, that the Confetti Battle and Colour Rush, the latter a vital fund-raising event, can be popularised shifted from midweek to a Saturday, but most of all, Loz stressed on the fatigue of the volunteers after a fortnight’s full schedule of activities, by the time the actual carnival arrives “they’re shattered!”

 

I find this very easy to believe, as a punter, I confess I overdo it at the Street Festival and by the following week, when carnival moves through town, I’m like “really? Can I be bothered?!” Given the choice I’d take the Street Festival over the carnival any day, but I think both are as vital as each other. A reply suggesting organising positions should be unpaid infuriated me, considering how much work is necessary to stage such events; could you do that as a hobby, my friend?

 

In fact, go against popular opinion as I may, I fully support the change of date, seeing it as a great decision which although must’ve been tricky to call, will benefit the town as a whole. Many a comment on this Facebook poll incensed me, truth be told; a stab at why DOCA paid for outside bands to play at the festival, when this year, as previous, I’ve felt the bookings have been justified and welcomed; didn’t see anyone complaining when we danced in the Market Place, a place usually reserved for wandering across from the shops to catch the bus.

 

5g

I did stress to Loz I’d like to see the wealth of local musical talent represented too, though she pointed out timeslots and the need for breaks in performances on the main stage, so that the circus side acts and street theatre could be heard. I offered the idea of a second stage for our local heroes, and Loz remarked it’d be another grand for a PA, and we’re back to stage one with the lack of funding.

 
Giving more clout to the need to support and attend the year’s fund-raising events, such as the impending Devizes Festival of Winter Ales at The Corn Exchange on the 15th and 16th of Feb. With a beer and cider selection curated by local Stealth Brew Co, it does indeed host local musical talent, such as George Wilding who will be playing this year, “and a cabaret too!” Loz enthusiastically added.

wintrerales

We breezed over successful city carnivals, such as Bath, whose sponsorship from local business are obviously more plentiful, attraction much wider, and solely concentrate on carnival, unlike DOCA who take the Street Festival, Picnic in the Park, The Confetti Battle, Colour Rush, Christmas Lantern Parade, and Winter Ales Festival under their wings; forgive me if I’ve missed one out, but that’s a truckload of things to arrange.

IMG_2569

In an area as affluent as this, Arts Funding will always give with one eyed squinted, it really is up to us support and fund DOCA. So please treat this bulletin as cautionary, consider damage done by taking our major events for granted and do whatever you can to help DOCA. One phone call with Loz, confirmed my already concrete notion that she is thoroughly dedicated to this position, is worthy and capable of the task. Think, while we have other great events in our wonderful town, they usually come with a price tag.

 
You know what? I blame the bad weather, yeah, the stresses over national politics and so on; understandably tetchy in February, but decent summer entertainment is that one time to put cares aside, let your hair down; don’t let austerity take it away.

Devizes Outside Celebratory Arts (DOCA)

logo230

 

Adverts & All That!

youngrockhopcharitylionsruzzaadamsterryhen2019txtmikeowllittle genevapostbuddyhollylivesborntorumhauntedpostsadleback-blues-festival-logo-2019ScooterRallyupdateposter2pricesstove1vinylrealmdirectoryheader

New Band, Old Roots: Little Geneva

If Devizes folk have a love of blues, with a slash to rock, and all this I find a beautiful thing; Long Street Blues Club, the origins of Saddleback and of course our own legend Jon Amor, there have been occasions when a portion of visiting bands I take with a pinch. There’s cliché, whereas roots of blues are strictly raw, these convey the conventional, an earnest shot to commercialise to a middle-aged tolerable market, which in a way is fine and dandy, there’s clearly a thirst for it and historically such progress is natural.

 
You see where I’m coming from? At a time, Elvis was unacceptable, was edgy, now the rock n roll audience is pensioner age, consider it classic. Marlborough’s popular Jazz Festival fills with hoity-toity yet the rags of Scott Joplin at the time of their conception could only be heard in bawdy New York brothels. Similarly, I hear a once subversive, outrageous noise of nineties rave as a children’s TV cartoon theme tune.

 
From the crashing drums and thrumming guitar opening blast of “Key to Love,” there’s no doubt barriers have been stripped back. Echoes of raw energy from a time of yore rip through you, its two and a half minutes of screeching harmonica and growling vocals place you in 1967, under a blanket at an LA love-in. Little Geneva maybe newly constructed, but resonance images of The Animals, of Steppenwolf and the Stones with a truly proficient edge.

lg

Putting my point to them, they agreed, “we feel very similar to you mate, very similar indeed… which is why we made those recordings, and, in the stripped back/vintage way we did.”

This EP satisfies retrospective mod-culture and beatniks more-so than contemporary indie fans, I’d say; imagine punk didn’t happen. “All Your Love” slides you into the smooth classical/jazz stimulus of The Doors, yet “Yer Blues” harks the blues which would’ve inspired these aforementioned legends. “Someday After a While,” again breezy melancholic blues sound of Cream or The Animals. Five tracks on this EP, but from the first note I was hooked.

 

lgchris

Bristol-based, Little Geneva, name coined from a Muddy Waters track, only formed on the eve before 2019, conceived during a conversation between the Doherty brothers, Dave and Chris. Partisans of the UK contemporary blues scene for over a decade, they felt a need to get back on stage together, as part of a truly great live band; thus, Little Geneva spawned. Once the seed was sown, recruiting additional members didn’t prove a problem.

 
Chris, 32, and Dave Doherty, 36; both gifted guitarists, holding players such as B.B King, Albert King, Jimi Hendrix and Eric Clapton in high regard, headhunted Rags Russell, 32, (vocals/harmonica) who fronts the youthful and energetic band with an emotive and soulful vocal style. Zak Ranyard, 27, (bass guitar) and Simon Small, 33, (drums) provide the rhythm section’s high level of energy and power, driving the band.

 
Having completed this blinding EP, the band is set to record their first album at the beginning of March, as they look for clubs and festivals dates across Europe. But the bestest part of it all, the album launch gig is based right here, in Devizes. I had to ask them, the connection.

little genevapost

You may know already, you see that’s where Devizine differs from being our town’s Time Out magazine, it’s a learning curve for me. There’s history behind this band, as individuals, Little Geneva members have opened shows for Ray Davies (The Kinks), John Fogerty (Creedence Clearwater Revival), Mud Morganfield and Lynyrd Skynyrd. Also sharing festival bills with The Red Devils, Jimmie Vaughan, The Hoax, B.B King and many others. But three members of the band began their musical relationship in Devizes, back in 2004. Chris, Simon and Dave went to Lavington Comprehensive.

 

lg3
“We all lived in Devizes at the time our first band formed,” explained Dave, “and we were quickly recruited by other older stalwarts of the scene. We helped create a thriving music scene at The Bell by The Green around this time and it was, for a time, a great little scene.”

 
“They go right back to the beginning of Sheer,” Sheer’s creator Kieran Moore informed, “Check out a band called Hitchmo; that’s where it started.”

 
“That early band came to an end around 2008,” Dave continued, “and the three of us went our separate ways, musically speaking. We all met other musicians, worked with other producers in different genres and countries. Chris now lives in Cornwall, as does Zak. Rags lives in Bristol, as did I when I met him. Simon and I now live in Devizes, where we feel rooted. Bristol is the hub of our activities; it’s obviously a more connected place than Devizes. Devizes is our home though, and all three of want to come back here for our first show, and smash it out of the park!”

lg2
It’s Little Geneva’s deep respect for, and knowledge of what made those early British blues recordings so energised, and exhilarating, coupled with the soulful spirit with which all members express themselves, that will make an unmissable launch date at The Cellar Bar on Saturday 23rd March. Initial reaction to this retrospective goodness was wow, great booking Kieran, but I see now, what’s news to me is a reunion, to a degree, for Sheer and aforementioned scene; indisputably making the gig even more poignant than simply this absolutely rocking sound.

 

I shit you not, it’s like being bought up with Neil Sedaka and suddenly discovering The Faces. Oh, and if you need more convincing, Jon Amor supports…. supports, I know, right!

Website www.littlegenevaband.co.uk
Email: bookings@littlegenevaband.co.uk

Facebook Event Page

 

Adverts & That!

mikeowlwintreralesborntorumbuddyhollylivesruzzsicrantimagetxt1

vinylrealmterryhen2019txtstove1